Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N7CS44

Protein Details
Accession A0A5N7CS44    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MGKKKIKQKRNKSNKHKTNAIYRIHydrophilic
NLS Segment(s)
PositionSequence
3-17KKKIKQKRNKSNKHK
Subcellular Location(s) mito 10.5, plas 10, cyto_mito 6, E.R. 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MGKKKIKQKRNKSNKHKTNAIYRIDISLPSGIHIHFLVLYVRTNPVVYFLFMKVFIFCSWFHDLSYEEWVCCAPLLSRGTEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.95
2 0.92
3 0.89
4 0.83
5 0.82
6 0.79
7 0.72
8 0.64
9 0.55
10 0.49
11 0.41
12 0.36
13 0.26
14 0.2
15 0.15
16 0.12
17 0.13
18 0.1
19 0.1
20 0.1
21 0.08
22 0.06
23 0.07
24 0.07
25 0.07
26 0.07
27 0.07
28 0.07
29 0.07
30 0.08
31 0.07
32 0.09
33 0.09
34 0.09
35 0.11
36 0.1
37 0.11
38 0.11
39 0.12
40 0.09
41 0.11
42 0.1
43 0.1
44 0.1
45 0.14
46 0.19
47 0.19
48 0.19
49 0.19
50 0.2
51 0.2
52 0.27
53 0.23
54 0.18
55 0.18
56 0.18
57 0.17
58 0.15
59 0.14
60 0.08
61 0.13
62 0.16