Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6FWH7

Protein Details
Accession A0A5N6FWH7   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
61-80MINSNKKKATKAKAAAKKKTHydrophilic
NLS Segment(s)
PositionSequence
66-80KKKATKAKAAAKKKT
Subcellular Location(s) E.R. 5, cyto 3, extr 2, mito 4, mito_nucl 2, plas 10, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR009914  DPM2  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0030234  F:enzyme regulator activity  
GO:0019348  P:dolichol metabolic process  
GO:0006486  P:protein glycosylation  
Pfam View protein in Pfam  
PF07297  DPM2  
Amino Acid Sequences MLLAATAIFLYYTTWTLLMPFVDEHHPLHSLFPPRVWAIRIPVILTLLGSAVVGTFIGIVMINSNKKKATKAKAAAKKKT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.09
4 0.1
5 0.09
6 0.09
7 0.08
8 0.1
9 0.12
10 0.14
11 0.14
12 0.14
13 0.15
14 0.14
15 0.16
16 0.18
17 0.2
18 0.19
19 0.19
20 0.19
21 0.19
22 0.2
23 0.19
24 0.16
25 0.15
26 0.18
27 0.18
28 0.16
29 0.15
30 0.14
31 0.13
32 0.12
33 0.08
34 0.05
35 0.04
36 0.04
37 0.03
38 0.03
39 0.03
40 0.03
41 0.02
42 0.02
43 0.02
44 0.03
45 0.03
46 0.03
47 0.04
48 0.08
49 0.13
50 0.15
51 0.17
52 0.21
53 0.23
54 0.3
55 0.38
56 0.44
57 0.5
58 0.59
59 0.67
60 0.74