Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H1VW78

Protein Details
Accession H1VW78    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MGKRKSSSKPQGPKKKDPLPSKFTCHydrophilic
NLS Segment(s)
PositionSequence
3-16KRKSSSKPQGPKKK
Subcellular Location(s) mito 15, cyto 8.5, cyto_nucl 6.5, nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
GO:0003746  F:translation elongation factor activity  
KEGG chig:CH63R_04490  -  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGKRKSSSKPQGPKKKDPLPSKFTCLFCNHEDSVAVKLDKKAGVGSLDCRVCGQMFQCSINYLSAAVDVYGEWVDAADAVAKEAGPIGGSQNKISNARRAPPSRPVNDDDEDDRRYGGEGIDVDDDEY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.88
3 0.87
4 0.86
5 0.84
6 0.81
7 0.77
8 0.74
9 0.71
10 0.64
11 0.59
12 0.52
13 0.48
14 0.42
15 0.43
16 0.36
17 0.3
18 0.29
19 0.25
20 0.24
21 0.22
22 0.2
23 0.16
24 0.17
25 0.19
26 0.18
27 0.18
28 0.15
29 0.13
30 0.14
31 0.14
32 0.15
33 0.18
34 0.17
35 0.17
36 0.17
37 0.16
38 0.14
39 0.14
40 0.13
41 0.11
42 0.12
43 0.13
44 0.13
45 0.14
46 0.14
47 0.14
48 0.13
49 0.08
50 0.07
51 0.06
52 0.06
53 0.05
54 0.04
55 0.03
56 0.04
57 0.04
58 0.04
59 0.03
60 0.03
61 0.03
62 0.03
63 0.03
64 0.04
65 0.04
66 0.04
67 0.05
68 0.04
69 0.04
70 0.05
71 0.05
72 0.03
73 0.04
74 0.06
75 0.1
76 0.11
77 0.12
78 0.16
79 0.19
80 0.24
81 0.26
82 0.32
83 0.32
84 0.37
85 0.45
86 0.46
87 0.48
88 0.53
89 0.59
90 0.56
91 0.58
92 0.56
93 0.53
94 0.51
95 0.5
96 0.45
97 0.41
98 0.39
99 0.34
100 0.3
101 0.24
102 0.23
103 0.2
104 0.15
105 0.13
106 0.12
107 0.14
108 0.16