Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6G4F8

Protein Details
Accession A0A5N6G4F8    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
163-184GEVRRNPRRKFPKGPKLRWGEKBasic
NLS Segment(s)
PositionSequence
166-180RRNPRRKFPKGPKLR
372-375RKRR
Subcellular Location(s) plas 9, mito 4, cyto 3.5, cyto_nucl 3.5, golg 3, nucl 2.5, E.R. 2, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR045888  Erv  
IPR012936  Erv_C  
IPR039542  Erv_N  
Gene Ontology GO:0030134  C:COPII-coated ER to Golgi transport vesicle  
GO:0005789  C:endoplasmic reticulum membrane  
GO:0033116  C:endoplasmic reticulum-Golgi intermediate compartment membrane  
GO:0000139  C:Golgi membrane  
GO:0006888  P:endoplasmic reticulum to Golgi vesicle-mediated transport  
GO:0006890  P:retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum  
Pfam View protein in Pfam  
PF07970  COPIIcoated_ERV  
PF13850  ERGIC_N  
Amino Acid Sequences MNGFATRGLDEDAFGEKSGLQAGLKTFDAFPKTKPSYTAPSRRGGQWTVLILLICTVFSLSEFKTWFKGSENHHFSVEKGVSHDLQLNLDVVVQMPCDALHVNIQDASGDRILAGELLKKDPTSWKLWMDKRNSDHEYQTLSQEDASRLEAQEEDAQVGHVLGEVRRNPRRKFPKGPKLRWGEKADSCRIYGSLEGNKVQGDFHITARGHGYRDMGGHLDHGTFNFSHMITELSFGPHYPTLLNPLDKTIATTESHYYKYQYFLSVVPTIYSKGHQAALDSTLSSKPLHSKNVIFTNQYAATSQAAELPESPYYIPGIFFKYNIEPILLMISEERGSFLSLLIRLVNTVSGVMVTGGWVYQIAGWAGELVRRKRRGRSEGVLDGKLAEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.12
4 0.13
5 0.14
6 0.14
7 0.1
8 0.12
9 0.13
10 0.16
11 0.17
12 0.18
13 0.17
14 0.21
15 0.26
16 0.25
17 0.27
18 0.34
19 0.38
20 0.38
21 0.41
22 0.42
23 0.46
24 0.55
25 0.63
26 0.57
27 0.6
28 0.61
29 0.62
30 0.62
31 0.54
32 0.48
33 0.43
34 0.39
35 0.33
36 0.31
37 0.26
38 0.2
39 0.19
40 0.14
41 0.09
42 0.07
43 0.06
44 0.05
45 0.06
46 0.09
47 0.09
48 0.13
49 0.15
50 0.16
51 0.2
52 0.21
53 0.22
54 0.23
55 0.29
56 0.31
57 0.4
58 0.46
59 0.44
60 0.45
61 0.44
62 0.41
63 0.43
64 0.38
65 0.28
66 0.24
67 0.25
68 0.22
69 0.23
70 0.27
71 0.19
72 0.19
73 0.18
74 0.16
75 0.13
76 0.13
77 0.12
78 0.08
79 0.07
80 0.07
81 0.06
82 0.06
83 0.05
84 0.06
85 0.07
86 0.06
87 0.1
88 0.1
89 0.11
90 0.11
91 0.11
92 0.11
93 0.11
94 0.13
95 0.09
96 0.09
97 0.08
98 0.07
99 0.07
100 0.08
101 0.07
102 0.09
103 0.1
104 0.12
105 0.13
106 0.13
107 0.14
108 0.2
109 0.23
110 0.24
111 0.26
112 0.3
113 0.38
114 0.45
115 0.51
116 0.52
117 0.56
118 0.55
119 0.6
120 0.58
121 0.52
122 0.47
123 0.42
124 0.4
125 0.34
126 0.32
127 0.25
128 0.21
129 0.2
130 0.2
131 0.18
132 0.14
133 0.15
134 0.13
135 0.12
136 0.13
137 0.12
138 0.12
139 0.13
140 0.12
141 0.11
142 0.09
143 0.09
144 0.09
145 0.09
146 0.07
147 0.05
148 0.05
149 0.05
150 0.09
151 0.13
152 0.2
153 0.27
154 0.34
155 0.35
156 0.45
157 0.55
158 0.59
159 0.67
160 0.71
161 0.75
162 0.79
163 0.83
164 0.82
165 0.8
166 0.78
167 0.75
168 0.69
169 0.64
170 0.59
171 0.58
172 0.54
173 0.46
174 0.41
175 0.33
176 0.28
177 0.23
178 0.19
179 0.16
180 0.14
181 0.14
182 0.15
183 0.15
184 0.14
185 0.14
186 0.13
187 0.1
188 0.1
189 0.1
190 0.1
191 0.15
192 0.15
193 0.16
194 0.18
195 0.2
196 0.16
197 0.16
198 0.16
199 0.12
200 0.12
201 0.12
202 0.11
203 0.09
204 0.1
205 0.09
206 0.09
207 0.08
208 0.08
209 0.09
210 0.08
211 0.09
212 0.09
213 0.08
214 0.08
215 0.08
216 0.09
217 0.07
218 0.09
219 0.08
220 0.08
221 0.08
222 0.08
223 0.1
224 0.1
225 0.1
226 0.09
227 0.09
228 0.14
229 0.17
230 0.18
231 0.16
232 0.17
233 0.18
234 0.17
235 0.19
236 0.14
237 0.13
238 0.13
239 0.15
240 0.16
241 0.18
242 0.2
243 0.2
244 0.21
245 0.19
246 0.22
247 0.21
248 0.19
249 0.18
250 0.16
251 0.2
252 0.2
253 0.19
254 0.16
255 0.16
256 0.16
257 0.15
258 0.15
259 0.13
260 0.12
261 0.15
262 0.14
263 0.15
264 0.15
265 0.16
266 0.16
267 0.14
268 0.14
269 0.12
270 0.13
271 0.13
272 0.12
273 0.17
274 0.21
275 0.26
276 0.29
277 0.31
278 0.36
279 0.45
280 0.46
281 0.41
282 0.37
283 0.38
284 0.35
285 0.32
286 0.26
287 0.19
288 0.17
289 0.16
290 0.15
291 0.13
292 0.12
293 0.12
294 0.13
295 0.14
296 0.13
297 0.14
298 0.14
299 0.11
300 0.12
301 0.12
302 0.12
303 0.11
304 0.17
305 0.16
306 0.17
307 0.19
308 0.21
309 0.24
310 0.23
311 0.22
312 0.16
313 0.16
314 0.18
315 0.15
316 0.11
317 0.09
318 0.1
319 0.1
320 0.1
321 0.1
322 0.09
323 0.1
324 0.1
325 0.1
326 0.12
327 0.12
328 0.13
329 0.13
330 0.12
331 0.12
332 0.12
333 0.12
334 0.08
335 0.08
336 0.07
337 0.06
338 0.06
339 0.06
340 0.05
341 0.05
342 0.05
343 0.05
344 0.05
345 0.05
346 0.05
347 0.05
348 0.07
349 0.07
350 0.07
351 0.07
352 0.08
353 0.09
354 0.12
355 0.19
356 0.25
357 0.35
358 0.43
359 0.49
360 0.57
361 0.68
362 0.73
363 0.75
364 0.76
365 0.76
366 0.77
367 0.78
368 0.7
369 0.6