Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6G4S8

Protein Details
Accession A0A5N6G4S8   
Localization Confidence High
Confidence Score 15.6
NoLS Segment(s)
PositionSequenceProtein Nature
17-46KGSKVNDGRIEKKKKKSKKTNPEPSTQQKEBasic
NLS Segment(s)
PositionSequence
13-36KLKLKGSKVNDGRIEKKKKKSKKT
85-106RKHEEMRRKRLQERLKREGVKT
Subcellular Location(s) cyto_nucl 13, mito 4, nucl 21.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013865  FAM32A  
Pfam View protein in Pfam  
PF08555  FAM32A  
Amino Acid Sequences MPADEYSVGGAGKLKLKGSKVNDGRIEKKKKKSKKTNPEPSTQQKEGSESAPAAASDERKSPEPPAKDGSGSEAVSGVGKTEAERKHEEMRRKRLQERLKREGVKTHKERVEELNKYLSRLSEHHDMPKIGPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.23
3 0.26
4 0.33
5 0.37
6 0.45
7 0.45
8 0.52
9 0.57
10 0.6
11 0.65
12 0.68
13 0.73
14 0.71
15 0.76
16 0.78
17 0.81
18 0.85
19 0.88
20 0.9
21 0.9
22 0.93
23 0.94
24 0.88
25 0.86
26 0.84
27 0.82
28 0.79
29 0.69
30 0.61
31 0.5
32 0.48
33 0.42
34 0.34
35 0.26
36 0.17
37 0.16
38 0.13
39 0.12
40 0.1
41 0.09
42 0.1
43 0.1
44 0.12
45 0.13
46 0.14
47 0.16
48 0.18
49 0.23
50 0.24
51 0.26
52 0.27
53 0.26
54 0.25
55 0.24
56 0.24
57 0.21
58 0.19
59 0.16
60 0.12
61 0.11
62 0.11
63 0.11
64 0.07
65 0.04
66 0.05
67 0.05
68 0.12
69 0.14
70 0.18
71 0.21
72 0.25
73 0.34
74 0.39
75 0.49
76 0.52
77 0.6
78 0.66
79 0.69
80 0.71
81 0.71
82 0.76
83 0.77
84 0.77
85 0.75
86 0.75
87 0.73
88 0.7
89 0.7
90 0.68
91 0.68
92 0.64
93 0.65
94 0.6
95 0.57
96 0.58
97 0.58
98 0.59
99 0.52
100 0.5
101 0.5
102 0.46
103 0.46
104 0.45
105 0.37
106 0.31
107 0.28
108 0.31
109 0.3
110 0.32
111 0.38
112 0.42
113 0.42