Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6FSN5

Protein Details
Accession A0A5N6FSN5    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
102-129CKAGMMGLKKRDRKKGKAKGKGASKAAKBasic
NLS Segment(s)
PositionSequence
109-130LKKRDRKKGKAKGKGASKAAKA
Subcellular Location(s) mito 11, nucl 9.5, cyto_nucl 8.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003210  Signal_recog_particle_SRP14  
IPR009018  Signal_recog_particle_SRP9/14  
Gene Ontology GO:0005786  C:signal recognition particle, endoplasmic reticulum targeting  
GO:0008312  F:7S RNA binding  
GO:0030942  F:endoplasmic reticulum signal peptide binding  
GO:0006614  P:SRP-dependent cotranslational protein targeting to membrane  
Pfam View protein in Pfam  
PF02290  SRP14  
Amino Acid Sequences MAPHLGHEEFFSSLSDLLSKTSQKTRGSVFLTQKPLIDTTASSETDLSSRPSILIRATDGNTNAPNPKNNKVEKKTITKVKLSTIVAPEDLETFYTRYAEVCKAGMMGLKKRDRKKGKAKGKGASKAAKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.1
4 0.12
5 0.14
6 0.15
7 0.18
8 0.24
9 0.31
10 0.32
11 0.35
12 0.36
13 0.4
14 0.43
15 0.47
16 0.47
17 0.47
18 0.51
19 0.48
20 0.46
21 0.4
22 0.36
23 0.29
24 0.23
25 0.16
26 0.15
27 0.18
28 0.17
29 0.16
30 0.15
31 0.15
32 0.15
33 0.15
34 0.13
35 0.1
36 0.1
37 0.1
38 0.1
39 0.11
40 0.11
41 0.11
42 0.1
43 0.12
44 0.12
45 0.14
46 0.14
47 0.14
48 0.14
49 0.15
50 0.16
51 0.15
52 0.19
53 0.21
54 0.27
55 0.32
56 0.37
57 0.46
58 0.47
59 0.54
60 0.55
61 0.6
62 0.61
63 0.62
64 0.6
65 0.55
66 0.53
67 0.48
68 0.48
69 0.41
70 0.37
71 0.31
72 0.29
73 0.24
74 0.23
75 0.2
76 0.14
77 0.13
78 0.11
79 0.09
80 0.09
81 0.09
82 0.09
83 0.09
84 0.09
85 0.12
86 0.13
87 0.13
88 0.13
89 0.12
90 0.12
91 0.13
92 0.15
93 0.16
94 0.21
95 0.29
96 0.37
97 0.45
98 0.52
99 0.63
100 0.69
101 0.75
102 0.8
103 0.82
104 0.85
105 0.87
106 0.88
107 0.87
108 0.88
109 0.86
110 0.83