Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H1W1F4

Protein Details
Accession H1W1F4   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
183-210MVGWRVPFWRERRKKRRVKKSHVIVVKEBasic
NLS Segment(s)
PositionSequence
192-202RERRKKRRVKK
Subcellular Location(s) plas 22, E.R. 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MASCQVQGEPELYGLGIRVAFYIQWFGAIVVEYLEVADLPDMRLVGLLFSAAAFVGLVIQLSMAALQPADIYIVLLLAMGIYLPLVPLYAWKAVTGFNPYWDPFRWSNEPSRAFRGLDFTLLLATTSLAIWYWCSFVPENPCSSGQYGFLFSRVSLGNKGFIASNAIMYFVILLVCLLVLLLMVGWRVPFWRERRKKRRVKKSHVIVVKELRTLSNIAVAATLTAAVELXVSWNDITSANYVSDVAQVLPLLVSAGFLVRVLFLHFAGVDGESESSEEDSDEGSRSYTTESPGGLPPAPPPAHARR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.07
4 0.07
5 0.07
6 0.07
7 0.08
8 0.08
9 0.11
10 0.09
11 0.1
12 0.1
13 0.1
14 0.1
15 0.1
16 0.09
17 0.07
18 0.07
19 0.06
20 0.06
21 0.06
22 0.05
23 0.04
24 0.05
25 0.05
26 0.06
27 0.07
28 0.07
29 0.07
30 0.08
31 0.07
32 0.07
33 0.06
34 0.05
35 0.04
36 0.04
37 0.05
38 0.04
39 0.04
40 0.03
41 0.03
42 0.03
43 0.03
44 0.03
45 0.03
46 0.03
47 0.03
48 0.03
49 0.03
50 0.03
51 0.03
52 0.03
53 0.03
54 0.04
55 0.04
56 0.04
57 0.04
58 0.04
59 0.04
60 0.04
61 0.04
62 0.03
63 0.03
64 0.02
65 0.02
66 0.02
67 0.02
68 0.02
69 0.02
70 0.02
71 0.02
72 0.03
73 0.03
74 0.04
75 0.07
76 0.09
77 0.09
78 0.09
79 0.1
80 0.11
81 0.13
82 0.17
83 0.15
84 0.16
85 0.18
86 0.19
87 0.21
88 0.21
89 0.25
90 0.21
91 0.27
92 0.29
93 0.3
94 0.36
95 0.42
96 0.46
97 0.44
98 0.47
99 0.44
100 0.4
101 0.37
102 0.35
103 0.27
104 0.22
105 0.19
106 0.14
107 0.11
108 0.11
109 0.1
110 0.05
111 0.05
112 0.04
113 0.04
114 0.04
115 0.03
116 0.03
117 0.04
118 0.05
119 0.06
120 0.06
121 0.08
122 0.08
123 0.11
124 0.17
125 0.18
126 0.19
127 0.2
128 0.21
129 0.2
130 0.2
131 0.19
132 0.14
133 0.13
134 0.14
135 0.12
136 0.12
137 0.11
138 0.09
139 0.11
140 0.1
141 0.11
142 0.1
143 0.11
144 0.11
145 0.11
146 0.12
147 0.1
148 0.09
149 0.11
150 0.09
151 0.1
152 0.08
153 0.08
154 0.08
155 0.07
156 0.07
157 0.04
158 0.04
159 0.03
160 0.03
161 0.02
162 0.02
163 0.02
164 0.02
165 0.02
166 0.02
167 0.01
168 0.02
169 0.02
170 0.02
171 0.02
172 0.02
173 0.03
174 0.03
175 0.05
176 0.11
177 0.18
178 0.3
179 0.4
180 0.52
181 0.63
182 0.73
183 0.83
184 0.88
185 0.92
186 0.92
187 0.92
188 0.92
189 0.91
190 0.89
191 0.85
192 0.77
193 0.72
194 0.68
195 0.6
196 0.51
197 0.41
198 0.32
199 0.27
200 0.25
201 0.19
202 0.16
203 0.14
204 0.12
205 0.12
206 0.11
207 0.09
208 0.08
209 0.08
210 0.04
211 0.03
212 0.03
213 0.03
214 0.03
215 0.03
216 0.04
217 0.04
218 0.05
219 0.05
220 0.06
221 0.06
222 0.07
223 0.09
224 0.09
225 0.09
226 0.09
227 0.1
228 0.09
229 0.1
230 0.1
231 0.08
232 0.08
233 0.07
234 0.07
235 0.07
236 0.06
237 0.05
238 0.04
239 0.04
240 0.04
241 0.04
242 0.04
243 0.05
244 0.05
245 0.05
246 0.05
247 0.07
248 0.08
249 0.07
250 0.08
251 0.08
252 0.08
253 0.09
254 0.09
255 0.08
256 0.07
257 0.08
258 0.07
259 0.08
260 0.08
261 0.08
262 0.08
263 0.07
264 0.07
265 0.08
266 0.09
267 0.1
268 0.09
269 0.1
270 0.1
271 0.1
272 0.14
273 0.15
274 0.17
275 0.18
276 0.19
277 0.21
278 0.24
279 0.27
280 0.24
281 0.23
282 0.22
283 0.28
284 0.28
285 0.27