Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6FT88

Protein Details
Accession A0A5N6FT88    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
146-167DMNGEKKKASRSKKAKDLAKTVHydrophilic
NLS Segment(s)
PositionSequence
127-131KKKQK
150-161EKKKASRSKKAK
Subcellular Location(s) nucl 13.5, mito_nucl 11.166, cyto_nucl 10.333, mito 7.5, cyto 5
Family & Domain DBs
Amino Acid Sequences MSSEPNGSINPPSAPDATVTSGVSTGKQTTDATLKQTNGDSTPINPVESDGSSEEKPAEATEIPKEHKLTEESKPSGPGSVAASAGPKEAIVANKTAQPGDKREHESTTAPADTTKVKAKSATEPVKKKQKITGKRTQNGTSTVPDMNGEKKKASRSKKAKDLAKTVIPTDGIGSRTRSRTKASP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.19
3 0.2
4 0.2
5 0.21
6 0.19
7 0.16
8 0.16
9 0.16
10 0.15
11 0.14
12 0.13
13 0.12
14 0.14
15 0.13
16 0.15
17 0.21
18 0.21
19 0.25
20 0.28
21 0.28
22 0.28
23 0.3
24 0.28
25 0.24
26 0.25
27 0.2
28 0.17
29 0.23
30 0.22
31 0.2
32 0.18
33 0.18
34 0.18
35 0.17
36 0.18
37 0.13
38 0.15
39 0.15
40 0.16
41 0.15
42 0.13
43 0.12
44 0.1
45 0.11
46 0.09
47 0.1
48 0.14
49 0.18
50 0.2
51 0.22
52 0.23
53 0.21
54 0.23
55 0.24
56 0.24
57 0.26
58 0.32
59 0.32
60 0.32
61 0.33
62 0.31
63 0.28
64 0.24
65 0.2
66 0.14
67 0.12
68 0.11
69 0.09
70 0.1
71 0.09
72 0.09
73 0.08
74 0.05
75 0.05
76 0.06
77 0.07
78 0.07
79 0.08
80 0.09
81 0.11
82 0.12
83 0.12
84 0.13
85 0.14
86 0.17
87 0.19
88 0.24
89 0.27
90 0.29
91 0.3
92 0.3
93 0.3
94 0.28
95 0.28
96 0.23
97 0.17
98 0.16
99 0.15
100 0.14
101 0.15
102 0.2
103 0.18
104 0.18
105 0.21
106 0.23
107 0.28
108 0.37
109 0.44
110 0.46
111 0.51
112 0.58
113 0.67
114 0.67
115 0.64
116 0.62
117 0.63
118 0.65
119 0.67
120 0.69
121 0.69
122 0.73
123 0.77
124 0.73
125 0.66
126 0.6
127 0.54
128 0.47
129 0.39
130 0.33
131 0.27
132 0.23
133 0.22
134 0.25
135 0.27
136 0.27
137 0.27
138 0.31
139 0.4
140 0.48
141 0.55
142 0.58
143 0.63
144 0.71
145 0.78
146 0.83
147 0.82
148 0.8
149 0.79
150 0.75
151 0.72
152 0.65
153 0.56
154 0.5
155 0.43
156 0.35
157 0.3
158 0.26
159 0.2
160 0.2
161 0.24
162 0.27
163 0.34
164 0.39
165 0.4