Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6FT88

Protein Details
Accession A0A5N6FT88   
Localization Confidence Medium
Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
146-167DMNGEKKKASRSKKAKDLAKTVHydrophilic
NLS Segment(s)
PositionSequence
127-131KKKQK
150-161EKKKASRSKKAK
Subcellular Location(s) cyto 5, cyto_nucl 10.333, mito 7.5, mito_nucl 11.166, nucl 13.5
Family & Domain DBs
Amino Acid Sequences MSSEPNGSINPPSAPDATVTSGVSTGKQTTDATLKQTNGDSTPINPVESDGSSEEKPAEATEIPKEHKLTEESKPSGPGSVAASAGPKEAIVANKTAQPGDKREHESTTAPADTTKVKAKSATEPVKKKQKITGKRTQNGTSTVPDMNGEKKKASRSKKAKDLAKTVIPTDGIGSRTRSRTKASP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.19
3 0.2
4 0.2
5 0.21
6 0.19
7 0.16
8 0.16
9 0.16
10 0.15
11 0.14
12 0.13
13 0.12
14 0.14
15 0.13
16 0.15
17 0.21
18 0.21
19 0.25
20 0.28
21 0.28
22 0.28
23 0.3
24 0.28
25 0.24
26 0.25
27 0.2
28 0.17
29 0.23
30 0.22
31 0.2
32 0.18
33 0.18
34 0.18
35 0.17
36 0.18
37 0.13
38 0.15
39 0.15
40 0.16
41 0.15
42 0.13
43 0.12
44 0.1
45 0.11
46 0.09
47 0.1
48 0.14
49 0.18
50 0.2
51 0.22
52 0.23
53 0.21
54 0.23
55 0.24
56 0.24
57 0.26
58 0.32
59 0.32
60 0.32
61 0.33
62 0.31
63 0.28
64 0.24
65 0.2
66 0.14
67 0.12
68 0.11
69 0.09
70 0.1
71 0.09
72 0.09
73 0.08
74 0.05
75 0.05
76 0.06
77 0.07
78 0.07
79 0.08
80 0.09
81 0.11
82 0.12
83 0.12
84 0.13
85 0.14
86 0.17
87 0.19
88 0.24
89 0.27
90 0.29
91 0.3
92 0.3
93 0.3
94 0.28
95 0.28
96 0.23
97 0.17
98 0.16
99 0.15
100 0.14
101 0.15
102 0.2
103 0.18
104 0.18
105 0.21
106 0.23
107 0.28
108 0.37
109 0.44
110 0.46
111 0.51
112 0.58
113 0.67
114 0.67
115 0.64
116 0.62
117 0.63
118 0.65
119 0.67
120 0.69
121 0.69
122 0.73
123 0.77
124 0.73
125 0.66
126 0.6
127 0.54
128 0.47
129 0.39
130 0.33
131 0.27
132 0.23
133 0.22
134 0.25
135 0.27
136 0.27
137 0.27
138 0.31
139 0.4
140 0.48
141 0.55
142 0.58
143 0.63
144 0.71
145 0.78
146 0.83
147 0.82
148 0.8
149 0.79
150 0.75
151 0.72
152 0.65
153 0.56
154 0.5
155 0.43
156 0.35
157 0.3
158 0.26
159 0.2
160 0.2
161 0.24
162 0.27
163 0.34
164 0.39
165 0.4