Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6FIB6

Protein Details
Accession A0A5N6FIB6   
Localization Confidence High
Confidence Score 22.7
NoLS Segment(s)
PositionSequenceProtein Nature
57-96LKSLEKSARYEKKHNPNPVDLEERSKKRKHTSPPGSREVHHydrophilic
358-389NDTGRTFKKKGQKRTTRRVRMKPVVTKPRRESBasic
471-528GSVKPPPTEKREKPSQPPVKEKETKPRERKINPAAHANYRSLKLRNKNSKGRGAGRFGHydrophilic
NLS Segment(s)
PositionSequence
80-93RSKKRKHTSPPGSR
102-106RKAAK
365-386KKKGQKRTTRRVRMKPVVTKPR
473-531VKPPPTEKREKPSQPPVKEKETKPRERKINPAAHANYRSLKLRNKNSKGRGAGRFGRRR
Subcellular Location(s) cyto 3.5, cyto_nucl 13.5, nucl 22.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR021110  DNA_rep_checkpnt_protein  
IPR040203  Sld2  
Gene Ontology GO:0005634  C:nucleus  
GO:0007049  P:cell cycle  
GO:0006270  P:DNA replication initiation  
Pfam View protein in Pfam  
PF11719  Drc1-Sld2  
CDD cd22289  RecQL4_SLD2_NTD  
Amino Acid Sequences MSSLDVADIASQSVKLRAELKDWERAFAAANEGRKADRSDIKNAPEIAAKYKEYSRLKSLEKSARYEKKHNPNPVDLEERSKKRKHTSPPGSREVHLESTPRKAAKGPFATPSKPRGVASHPSELDPYDSPSALRRLFSPTTHQQSSSPFKTAIGPTPQRDGKSLGLFDLLSESGGSTATPTASRIASVRGTAAQTPSKRNALDTIAEEDEEEDSPRGDRTPASASKSYMLSALFATPTTWRYATMMDDRNDAAPHERAQQTSANGAGQEAPESETPAFLRRANSARYGATNPTGQGLSPINVRKRPQFVGKGLSALVQGLRDMEEERLDDDLDVLREIEEEQAAVSTEVTDSQTVSNDTGRTFKKKGQKRTTRRVRMKPVVTKPRRESQLPESEQEDGTENTGYSEDELAAVPETQQPAVHADEAGGFSDFASLRSISEPELDSDSDYGEHAKPLTRNKSFSERMKEAIGSVKPPPTEKREKPSQPPVKEKETKPRERKINPAAHANYRSLKLRNKNSKGRGAGRFGRRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.16
3 0.21
4 0.22
5 0.26
6 0.34
7 0.37
8 0.43
9 0.43
10 0.43
11 0.39
12 0.37
13 0.35
14 0.27
15 0.31
16 0.24
17 0.27
18 0.27
19 0.27
20 0.28
21 0.29
22 0.31
23 0.3
24 0.35
25 0.36
26 0.43
27 0.49
28 0.52
29 0.55
30 0.53
31 0.47
32 0.44
33 0.41
34 0.39
35 0.37
36 0.34
37 0.31
38 0.34
39 0.42
40 0.42
41 0.46
42 0.47
43 0.49
44 0.52
45 0.56
46 0.61
47 0.61
48 0.6
49 0.62
50 0.65
51 0.68
52 0.7
53 0.72
54 0.73
55 0.75
56 0.79
57 0.82
58 0.77
59 0.76
60 0.75
61 0.71
62 0.68
63 0.58
64 0.58
65 0.58
66 0.59
67 0.6
68 0.59
69 0.61
70 0.63
71 0.71
72 0.72
73 0.74
74 0.78
75 0.8
76 0.84
77 0.85
78 0.79
79 0.71
80 0.65
81 0.59
82 0.52
83 0.43
84 0.4
85 0.34
86 0.36
87 0.41
88 0.37
89 0.33
90 0.33
91 0.36
92 0.41
93 0.45
94 0.42
95 0.44
96 0.49
97 0.52
98 0.51
99 0.52
100 0.48
101 0.43
102 0.41
103 0.38
104 0.38
105 0.43
106 0.44
107 0.47
108 0.42
109 0.4
110 0.4
111 0.37
112 0.34
113 0.26
114 0.24
115 0.17
116 0.17
117 0.16
118 0.18
119 0.23
120 0.21
121 0.21
122 0.19
123 0.24
124 0.26
125 0.28
126 0.32
127 0.35
128 0.42
129 0.43
130 0.43
131 0.38
132 0.42
133 0.49
134 0.44
135 0.38
136 0.31
137 0.3
138 0.34
139 0.34
140 0.33
141 0.34
142 0.36
143 0.35
144 0.42
145 0.44
146 0.4
147 0.4
148 0.37
149 0.32
150 0.31
151 0.3
152 0.23
153 0.21
154 0.2
155 0.18
156 0.16
157 0.12
158 0.07
159 0.07
160 0.06
161 0.05
162 0.06
163 0.05
164 0.04
165 0.05
166 0.05
167 0.06
168 0.06
169 0.08
170 0.08
171 0.09
172 0.09
173 0.11
174 0.12
175 0.12
176 0.12
177 0.12
178 0.13
179 0.14
180 0.16
181 0.19
182 0.21
183 0.25
184 0.28
185 0.3
186 0.29
187 0.28
188 0.28
189 0.25
190 0.24
191 0.22
192 0.22
193 0.19
194 0.18
195 0.17
196 0.15
197 0.13
198 0.11
199 0.11
200 0.07
201 0.07
202 0.07
203 0.08
204 0.08
205 0.07
206 0.07
207 0.09
208 0.16
209 0.19
210 0.24
211 0.25
212 0.26
213 0.27
214 0.27
215 0.24
216 0.19
217 0.16
218 0.11
219 0.1
220 0.09
221 0.08
222 0.07
223 0.07
224 0.07
225 0.08
226 0.09
227 0.09
228 0.09
229 0.1
230 0.11
231 0.13
232 0.18
233 0.23
234 0.22
235 0.23
236 0.23
237 0.23
238 0.22
239 0.2
240 0.16
241 0.12
242 0.12
243 0.16
244 0.17
245 0.16
246 0.18
247 0.2
248 0.19
249 0.18
250 0.17
251 0.12
252 0.11
253 0.11
254 0.09
255 0.07
256 0.06
257 0.06
258 0.07
259 0.07
260 0.08
261 0.08
262 0.08
263 0.08
264 0.11
265 0.12
266 0.12
267 0.13
268 0.15
269 0.19
270 0.2
271 0.23
272 0.22
273 0.21
274 0.22
275 0.23
276 0.21
277 0.19
278 0.18
279 0.15
280 0.15
281 0.14
282 0.11
283 0.12
284 0.11
285 0.1
286 0.13
287 0.18
288 0.21
289 0.25
290 0.27
291 0.29
292 0.33
293 0.36
294 0.39
295 0.4
296 0.39
297 0.41
298 0.39
299 0.36
300 0.31
301 0.28
302 0.21
303 0.15
304 0.12
305 0.07
306 0.07
307 0.06
308 0.06
309 0.06
310 0.07
311 0.07
312 0.07
313 0.08
314 0.08
315 0.09
316 0.08
317 0.08
318 0.07
319 0.08
320 0.07
321 0.07
322 0.07
323 0.06
324 0.06
325 0.07
326 0.07
327 0.05
328 0.05
329 0.05
330 0.05
331 0.05
332 0.05
333 0.05
334 0.04
335 0.04
336 0.05
337 0.06
338 0.06
339 0.06
340 0.07
341 0.08
342 0.09
343 0.1
344 0.11
345 0.11
346 0.12
347 0.17
348 0.2
349 0.25
350 0.27
351 0.32
352 0.4
353 0.48
354 0.58
355 0.63
356 0.71
357 0.76
358 0.84
359 0.89
360 0.91
361 0.93
362 0.91
363 0.91
364 0.89
365 0.88
366 0.86
367 0.86
368 0.86
369 0.83
370 0.82
371 0.77
372 0.76
373 0.72
374 0.65
375 0.61
376 0.58
377 0.62
378 0.56
379 0.52
380 0.45
381 0.42
382 0.39
383 0.34
384 0.28
385 0.17
386 0.15
387 0.14
388 0.12
389 0.1
390 0.11
391 0.1
392 0.08
393 0.09
394 0.07
395 0.07
396 0.08
397 0.07
398 0.08
399 0.08
400 0.08
401 0.1
402 0.11
403 0.1
404 0.11
405 0.11
406 0.13
407 0.15
408 0.15
409 0.12
410 0.11
411 0.12
412 0.13
413 0.13
414 0.1
415 0.08
416 0.08
417 0.11
418 0.11
419 0.1
420 0.12
421 0.11
422 0.11
423 0.13
424 0.14
425 0.12
426 0.15
427 0.15
428 0.14
429 0.17
430 0.17
431 0.16
432 0.15
433 0.15
434 0.13
435 0.12
436 0.14
437 0.11
438 0.13
439 0.13
440 0.17
441 0.21
442 0.3
443 0.4
444 0.41
445 0.44
446 0.48
447 0.57
448 0.6
449 0.64
450 0.64
451 0.58
452 0.55
453 0.55
454 0.5
455 0.42
456 0.42
457 0.36
458 0.29
459 0.3
460 0.32
461 0.3
462 0.34
463 0.39
464 0.41
465 0.49
466 0.54
467 0.58
468 0.65
469 0.72
470 0.77
471 0.82
472 0.83
473 0.82
474 0.85
475 0.82
476 0.82
477 0.82
478 0.79
479 0.79
480 0.8
481 0.82
482 0.81
483 0.84
484 0.84
485 0.82
486 0.86
487 0.85
488 0.84
489 0.77
490 0.78
491 0.73
492 0.72
493 0.69
494 0.63
495 0.58
496 0.52
497 0.54
498 0.51
499 0.54
500 0.55
501 0.63
502 0.69
503 0.74
504 0.8
505 0.83
506 0.86
507 0.85
508 0.84
509 0.81
510 0.79
511 0.79