Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6FZI0

Protein Details
Accession A0A5N6FZI0    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MKIRERKGKQKQKQRVPKPTCHLLPBasic
NLS Segment(s)
PositionSequence
4-15RERKGKQKQKQR
Subcellular Location(s) mito 16.5, cyto_mito 10, plas 3, cyto 2.5, pero 2
Family & Domain DBs
Amino Acid Sequences MKIRERKGKQKQKQRVPKPTCHLLPPFPYLTTLHHSMQFTLYGSFLLPGLRGALKGVVDNTEGSLWVLYVHTYIHTPLESPPLHIFIISSSIFGSWLLTVAMV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.94
2 0.93
3 0.9
4 0.9
5 0.86
6 0.85
7 0.77
8 0.72
9 0.66
10 0.6
11 0.56
12 0.51
13 0.45
14 0.36
15 0.34
16 0.29
17 0.27
18 0.27
19 0.26
20 0.23
21 0.25
22 0.25
23 0.24
24 0.23
25 0.21
26 0.16
27 0.13
28 0.12
29 0.08
30 0.08
31 0.07
32 0.06
33 0.05
34 0.05
35 0.04
36 0.05
37 0.05
38 0.05
39 0.05
40 0.06
41 0.06
42 0.06
43 0.06
44 0.06
45 0.07
46 0.07
47 0.07
48 0.07
49 0.07
50 0.06
51 0.06
52 0.05
53 0.05
54 0.05
55 0.04
56 0.04
57 0.05
58 0.05
59 0.06
60 0.07
61 0.08
62 0.08
63 0.09
64 0.09
65 0.17
66 0.16
67 0.19
68 0.2
69 0.21
70 0.21
71 0.2
72 0.19
73 0.13
74 0.17
75 0.14
76 0.13
77 0.1
78 0.1
79 0.11
80 0.11
81 0.11
82 0.06
83 0.07