Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6FBI2

Protein Details
Accession A0A5N6FBI2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
51-71EWNKLEKRYKIARKKWLVISSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 26
Family & Domain DBs
Amino Acid Sequences MVFSARFQHSPKKVHLISCPRVIRANNLDPDAQNLLQVKLDAVVERIPDSEWNKLEKRYKIARKKWLVISSMSEGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.59
3 0.59
4 0.56
5 0.6
6 0.57
7 0.49
8 0.51
9 0.47
10 0.45
11 0.42
12 0.44
13 0.37
14 0.37
15 0.36
16 0.31
17 0.33
18 0.3
19 0.22
20 0.17
21 0.15
22 0.14
23 0.13
24 0.13
25 0.1
26 0.07
27 0.08
28 0.06
29 0.06
30 0.06
31 0.07
32 0.07
33 0.08
34 0.07
35 0.12
36 0.14
37 0.18
38 0.19
39 0.24
40 0.26
41 0.33
42 0.4
43 0.4
44 0.46
45 0.51
46 0.6
47 0.66
48 0.72
49 0.76
50 0.78
51 0.81
52 0.82
53 0.78
54 0.7
55 0.62
56 0.59