Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6FE12

Protein Details
Accession A0A5N6FE12   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
269-294STITKKKKIGAPKKLSGKKPPPAPSSHydrophilic
NLS Segment(s)
PositionSequence
273-295KKKKIGAPKKLSGKKPPPAPSSK
Subcellular Location(s) cyto 10, cyto_nucl 14, nucl 16
Family & Domain DBs
InterPro View protein in InterPro  
IPR013246  SAGA_su_Sgf11  
Gene Ontology GO:0005634  C:nucleus  
GO:0070461  C:SAGA-type complex  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF08209  Sgf11  
Amino Acid Sequences MGESNGTEQQESSFPSGTIAKLTCDILNNTFYNIIHDIVSKVHRDEKVARMRSAVTMARQKAEEEAGRRREEAGAKPTALKPGEDFEELKNIRVETEGAIFEDGKVYLKGNPLQTTKEIICPDCRLPRLLYPLTGVGARPPPDPYREYCQKQPMINKPGHDVHGNPFATDKLNPKKKKQTNTSNTPASSPPTTPDGSFKQAAPEKVSFPTVKCPNCPRYFVVTRVAQHLDRCLGLSGRQTNRNKTPMENGASTPSSAPPKRPLDEDTPSTITKKKKIGAPKKLSGKKPPPAPSSKLKNGVTPDMAAAADAAAAGDGDVKSEANGDN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.2
3 0.22
4 0.2
5 0.22
6 0.2
7 0.18
8 0.19
9 0.21
10 0.2
11 0.22
12 0.24
13 0.22
14 0.27
15 0.25
16 0.25
17 0.25
18 0.23
19 0.24
20 0.23
21 0.21
22 0.17
23 0.17
24 0.16
25 0.18
26 0.21
27 0.19
28 0.2
29 0.26
30 0.27
31 0.31
32 0.36
33 0.42
34 0.49
35 0.52
36 0.51
37 0.46
38 0.46
39 0.43
40 0.42
41 0.36
42 0.31
43 0.34
44 0.35
45 0.36
46 0.35
47 0.33
48 0.3
49 0.32
50 0.3
51 0.27
52 0.34
53 0.38
54 0.39
55 0.39
56 0.38
57 0.38
58 0.38
59 0.39
60 0.36
61 0.34
62 0.33
63 0.35
64 0.35
65 0.37
66 0.33
67 0.27
68 0.23
69 0.22
70 0.25
71 0.24
72 0.24
73 0.18
74 0.27
75 0.27
76 0.27
77 0.26
78 0.22
79 0.21
80 0.2
81 0.2
82 0.11
83 0.13
84 0.12
85 0.11
86 0.11
87 0.11
88 0.1
89 0.1
90 0.09
91 0.08
92 0.08
93 0.08
94 0.1
95 0.14
96 0.17
97 0.2
98 0.24
99 0.25
100 0.27
101 0.27
102 0.29
103 0.27
104 0.28
105 0.26
106 0.23
107 0.24
108 0.25
109 0.28
110 0.29
111 0.29
112 0.26
113 0.26
114 0.28
115 0.32
116 0.3
117 0.27
118 0.23
119 0.22
120 0.21
121 0.19
122 0.15
123 0.11
124 0.14
125 0.14
126 0.13
127 0.16
128 0.17
129 0.2
130 0.22
131 0.23
132 0.28
133 0.35
134 0.38
135 0.4
136 0.46
137 0.47
138 0.48
139 0.52
140 0.53
141 0.5
142 0.49
143 0.44
144 0.41
145 0.4
146 0.38
147 0.31
148 0.23
149 0.21
150 0.27
151 0.26
152 0.21
153 0.19
154 0.18
155 0.18
156 0.19
157 0.23
158 0.25
159 0.34
160 0.38
161 0.45
162 0.55
163 0.61
164 0.69
165 0.71
166 0.73
167 0.73
168 0.77
169 0.77
170 0.72
171 0.65
172 0.58
173 0.49
174 0.41
175 0.33
176 0.25
177 0.2
178 0.18
179 0.19
180 0.17
181 0.21
182 0.21
183 0.23
184 0.24
185 0.22
186 0.26
187 0.28
188 0.29
189 0.29
190 0.27
191 0.25
192 0.25
193 0.29
194 0.23
195 0.2
196 0.28
197 0.31
198 0.31
199 0.35
200 0.41
201 0.47
202 0.49
203 0.52
204 0.46
205 0.47
206 0.49
207 0.47
208 0.46
209 0.41
210 0.39
211 0.4
212 0.4
213 0.32
214 0.3
215 0.29
216 0.24
217 0.2
218 0.19
219 0.16
220 0.13
221 0.14
222 0.19
223 0.24
224 0.28
225 0.37
226 0.41
227 0.47
228 0.53
229 0.57
230 0.54
231 0.48
232 0.51
233 0.49
234 0.49
235 0.44
236 0.38
237 0.37
238 0.36
239 0.33
240 0.27
241 0.24
242 0.27
243 0.26
244 0.29
245 0.33
246 0.39
247 0.41
248 0.43
249 0.44
250 0.44
251 0.49
252 0.48
253 0.46
254 0.43
255 0.42
256 0.41
257 0.42
258 0.4
259 0.41
260 0.44
261 0.43
262 0.46
263 0.56
264 0.64
265 0.7
266 0.73
267 0.76
268 0.8
269 0.83
270 0.84
271 0.84
272 0.83
273 0.8
274 0.8
275 0.8
276 0.77
277 0.76
278 0.74
279 0.74
280 0.74
281 0.74
282 0.73
283 0.66
284 0.63
285 0.61
286 0.62
287 0.54
288 0.45
289 0.37
290 0.29
291 0.28
292 0.22
293 0.16
294 0.1
295 0.07
296 0.06
297 0.05
298 0.03
299 0.03
300 0.03
301 0.06
302 0.06
303 0.07
304 0.08
305 0.08
306 0.08