Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6FDW1

Protein Details
Accession A0A5N6FDW1    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
17-39IEKRINEDSKKKRPTPSPGPEPSHydrophilic
NLS Segment(s)
PositionSequence
26-30KKKRP
147-167SKAAKERAKAKLEGREDLRKR
Subcellular Location(s) nucl 23.5, cyto_nucl 13
Family & Domain DBs
Amino Acid Sequences MGSKKTNKKSGLYSAAIEKRINEDSKKKRPTPSPGPEPSGSNKAKCERKGDDDEEVFTMDDFPTEVLLKAHYMATKQSSLDRPLGMFESDVTLAASIRAHAGANPPASDRENFAGTPLSNDAISNILKEVKPDCNKAQAWIKAHEASKAAKERAKAKLEGREDLRKRAVRLSYDRARQTASQSNAPRHEAGDLAPVAVPEVSEGRTVNEELEESRVVYNRVSLAHDRLLKTISDIEEFRKAVPQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.56
3 0.54
4 0.47
5 0.39
6 0.36
7 0.39
8 0.41
9 0.38
10 0.43
11 0.5
12 0.6
13 0.69
14 0.7
15 0.73
16 0.77
17 0.8
18 0.81
19 0.81
20 0.8
21 0.77
22 0.77
23 0.7
24 0.65
25 0.6
26 0.59
27 0.52
28 0.44
29 0.44
30 0.46
31 0.53
32 0.53
33 0.56
34 0.52
35 0.56
36 0.62
37 0.59
38 0.58
39 0.52
40 0.49
41 0.42
42 0.37
43 0.29
44 0.21
45 0.18
46 0.1
47 0.09
48 0.07
49 0.06
50 0.06
51 0.07
52 0.07
53 0.07
54 0.07
55 0.08
56 0.09
57 0.1
58 0.1
59 0.1
60 0.12
61 0.15
62 0.16
63 0.16
64 0.2
65 0.22
66 0.24
67 0.26
68 0.24
69 0.21
70 0.21
71 0.21
72 0.17
73 0.13
74 0.1
75 0.1
76 0.09
77 0.09
78 0.08
79 0.06
80 0.06
81 0.06
82 0.06
83 0.04
84 0.05
85 0.05
86 0.05
87 0.05
88 0.08
89 0.11
90 0.12
91 0.12
92 0.12
93 0.14
94 0.15
95 0.15
96 0.14
97 0.13
98 0.14
99 0.13
100 0.13
101 0.13
102 0.12
103 0.13
104 0.11
105 0.1
106 0.08
107 0.08
108 0.08
109 0.08
110 0.08
111 0.07
112 0.07
113 0.08
114 0.08
115 0.1
116 0.12
117 0.17
118 0.21
119 0.25
120 0.25
121 0.3
122 0.31
123 0.34
124 0.38
125 0.36
126 0.36
127 0.34
128 0.36
129 0.33
130 0.33
131 0.31
132 0.26
133 0.22
134 0.25
135 0.28
136 0.27
137 0.25
138 0.28
139 0.32
140 0.38
141 0.41
142 0.39
143 0.38
144 0.44
145 0.45
146 0.47
147 0.46
148 0.48
149 0.47
150 0.48
151 0.52
152 0.46
153 0.45
154 0.46
155 0.45
156 0.42
157 0.46
158 0.49
159 0.5
160 0.54
161 0.54
162 0.49
163 0.48
164 0.43
165 0.42
166 0.42
167 0.38
168 0.39
169 0.41
170 0.46
171 0.47
172 0.48
173 0.43
174 0.35
175 0.33
176 0.25
177 0.21
178 0.2
179 0.16
180 0.14
181 0.14
182 0.13
183 0.12
184 0.11
185 0.1
186 0.06
187 0.07
188 0.08
189 0.09
190 0.1
191 0.11
192 0.13
193 0.14
194 0.13
195 0.13
196 0.12
197 0.12
198 0.15
199 0.14
200 0.13
201 0.14
202 0.16
203 0.16
204 0.15
205 0.17
206 0.15
207 0.17
208 0.2
209 0.22
210 0.24
211 0.3
212 0.36
213 0.35
214 0.35
215 0.35
216 0.3
217 0.29
218 0.3
219 0.25
220 0.24
221 0.24
222 0.26
223 0.32
224 0.32