Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q8SRP1

Protein Details
Accession Q8SRP1   
Localization Confidence Medium
Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-34MKNAYKKVRVRYPVKRPDVKRKQRGPRAETQESRHydrophilic
NLS Segment(s)
PositionSequence
8-27VRVRYPVKRPDVKRKQRGPR
66-84AQKLLRKRLGSHKRAVAKV
Subcellular Location(s) mito 13, nucl 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR038097  L36e_sf  
IPR000509  Ribosomal_L36e  
Gene Ontology GO:0005737  C:cytoplasm  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG ecu:ECU06_1120  -  
Pfam View protein in Pfam  
PF01158  Ribosomal_L36e  
Amino Acid Sequences MKNAYKKVRVRYPVKRPDVKRKQRGPRAETQESRFLAAAVADEISGLSPLEKKAISLLEAKNNNKAQKLLRKRLGSHKRAVAKVEKLARMLLEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.85
3 0.83
4 0.85
5 0.87
6 0.88
7 0.87
8 0.87
9 0.88
10 0.88
11 0.9
12 0.85
13 0.84
14 0.82
15 0.8
16 0.75
17 0.69
18 0.66
19 0.57
20 0.51
21 0.41
22 0.32
23 0.23
24 0.18
25 0.14
26 0.07
27 0.06
28 0.04
29 0.04
30 0.04
31 0.04
32 0.04
33 0.03
34 0.03
35 0.04
36 0.04
37 0.06
38 0.06
39 0.06
40 0.07
41 0.08
42 0.1
43 0.14
44 0.16
45 0.22
46 0.29
47 0.3
48 0.36
49 0.4
50 0.4
51 0.37
52 0.38
53 0.38
54 0.43
55 0.52
56 0.54
57 0.59
58 0.62
59 0.65
60 0.73
61 0.76
62 0.72
63 0.7
64 0.68
65 0.68
66 0.65
67 0.66
68 0.62
69 0.57
70 0.59
71 0.59
72 0.53
73 0.47
74 0.45