Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N7C7Y8

Protein Details
Accession A0A5N7C7Y8    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MGQRHNRRRTRPRSRNRSAHFTPVHydrophilic
NLS Segment(s)
PositionSequence
7-15RRRTRPRSR
Subcellular Location(s) mito 20, cyto 4, nucl 2, cyto_pero 2
Family & Domain DBs
Amino Acid Sequences MGQRHNRRRTRPRSRNRSAHFTPVEPTPYPVSYTRTPAILETTTTACESLDSIPVPFAPTWHYKGTIWQKRDRTLRIETSQLEVEQCRLFGGEPGDDVGLCYRMLEYFGGLDYIDS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.94
2 0.94
3 0.9
4 0.88
5 0.81
6 0.8
7 0.71
8 0.62
9 0.54
10 0.47
11 0.44
12 0.35
13 0.33
14 0.27
15 0.24
16 0.26
17 0.25
18 0.27
19 0.25
20 0.29
21 0.27
22 0.25
23 0.24
24 0.22
25 0.23
26 0.18
27 0.16
28 0.13
29 0.13
30 0.13
31 0.13
32 0.12
33 0.09
34 0.08
35 0.08
36 0.07
37 0.08
38 0.07
39 0.07
40 0.07
41 0.08
42 0.09
43 0.08
44 0.07
45 0.09
46 0.12
47 0.15
48 0.16
49 0.18
50 0.16
51 0.25
52 0.35
53 0.39
54 0.41
55 0.44
56 0.48
57 0.54
58 0.6
59 0.55
60 0.5
61 0.49
62 0.51
63 0.47
64 0.47
65 0.4
66 0.37
67 0.35
68 0.3
69 0.26
70 0.19
71 0.19
72 0.15
73 0.14
74 0.11
75 0.1
76 0.1
77 0.11
78 0.13
79 0.11
80 0.1
81 0.12
82 0.12
83 0.11
84 0.12
85 0.1
86 0.09
87 0.09
88 0.08
89 0.08
90 0.08
91 0.09
92 0.09
93 0.08
94 0.08
95 0.09
96 0.09