Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H1UVG3

Protein Details
Accession H1UVG3    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-35MADRERSRSRSPRRDREKDRERPRKQGGFKWKDNSBasic
46-70LERGYRNRSRSPRRDADRDRRPRDGBasic
NLS Segment(s)
PositionSequence
6-117RSRSRSPRRDREKDRERPRKQGGFKWKDNSRRDDREDRRGLERGYRNRSRSPRRDADRDRRPRDGDRDRDRDRNRNNDSYRPRDSGARDSRPSASSSKDAPKAAKKEKPKPV
Subcellular Location(s) nucl 24.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039732  Hub1/Ubl5  
IPR029071  Ubiquitin-like_domsf  
Gene Ontology GO:0036211  P:protein modification process  
KEGG chig:CH63R_10901  -  
Amino Acid Sequences MADRERSRSRSPRRDREKDRERPRKQGGFKWKDNSRRDDREDRRGLERGYRNRSRSPRRDADRDRRPRDGDRDRDRDRNRNNDSYRPRDSGARDSRPSASSSKDAPKAAKKEKPKPVPAPAAGGEEMIIVHVNDRLGTKAAIPCLASDPVKMFKILVAARVGREPHEILLKRQGERPFKDNLTLEDYGVSNGVQLDLEVDTGD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.92
3 0.92
4 0.92
5 0.92
6 0.93
7 0.93
8 0.89
9 0.88
10 0.88
11 0.87
12 0.83
13 0.82
14 0.82
15 0.8
16 0.81
17 0.8
18 0.78
19 0.78
20 0.78
21 0.77
22 0.76
23 0.75
24 0.75
25 0.76
26 0.75
27 0.76
28 0.76
29 0.7
30 0.66
31 0.62
32 0.56
33 0.54
34 0.56
35 0.54
36 0.57
37 0.61
38 0.6
39 0.64
40 0.73
41 0.74
42 0.74
43 0.75
44 0.75
45 0.74
46 0.81
47 0.82
48 0.82
49 0.82
50 0.84
51 0.81
52 0.77
53 0.75
54 0.71
55 0.71
56 0.7
57 0.69
58 0.68
59 0.71
60 0.69
61 0.75
62 0.74
63 0.73
64 0.71
65 0.71
66 0.68
67 0.68
68 0.67
69 0.66
70 0.68
71 0.65
72 0.63
73 0.55
74 0.5
75 0.45
76 0.44
77 0.45
78 0.45
79 0.44
80 0.41
81 0.4
82 0.41
83 0.38
84 0.37
85 0.29
86 0.23
87 0.19
88 0.21
89 0.24
90 0.26
91 0.26
92 0.27
93 0.32
94 0.37
95 0.42
96 0.45
97 0.49
98 0.55
99 0.63
100 0.68
101 0.7
102 0.69
103 0.69
104 0.69
105 0.61
106 0.55
107 0.47
108 0.41
109 0.33
110 0.26
111 0.19
112 0.12
113 0.11
114 0.07
115 0.06
116 0.04
117 0.04
118 0.05
119 0.05
120 0.05
121 0.06
122 0.07
123 0.08
124 0.08
125 0.11
126 0.12
127 0.13
128 0.13
129 0.13
130 0.13
131 0.14
132 0.17
133 0.15
134 0.14
135 0.16
136 0.18
137 0.18
138 0.18
139 0.15
140 0.13
141 0.19
142 0.19
143 0.19
144 0.19
145 0.19
146 0.2
147 0.23
148 0.24
149 0.19
150 0.22
151 0.2
152 0.19
153 0.27
154 0.27
155 0.27
156 0.36
157 0.39
158 0.37
159 0.43
160 0.49
161 0.49
162 0.52
163 0.53
164 0.51
165 0.48
166 0.53
167 0.48
168 0.44
169 0.42
170 0.38
171 0.35
172 0.29
173 0.27
174 0.22
175 0.2
176 0.16
177 0.09
178 0.09
179 0.09
180 0.07
181 0.06
182 0.07
183 0.07