Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6G533

Protein Details
Accession A0A5N6G533   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
47-68LIAHPKLKIKHRANRWHQKGLFHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 4, extr 4, mito 17
Family & Domain DBs
Amino Acid Sequences MWQTLTWVLRLMYGSTGASIQGTLLPLVIPVTADKHITESDNGDVELIAHPKLKIKHRANRWHQKGLFAARPSSDCVRHAC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.11
4 0.09
5 0.08
6 0.07
7 0.06
8 0.06
9 0.06
10 0.06
11 0.06
12 0.05
13 0.05
14 0.05
15 0.05
16 0.04
17 0.04
18 0.06
19 0.07
20 0.08
21 0.08
22 0.09
23 0.1
24 0.11
25 0.11
26 0.11
27 0.11
28 0.1
29 0.1
30 0.08
31 0.08
32 0.07
33 0.08
34 0.07
35 0.07
36 0.08
37 0.08
38 0.13
39 0.18
40 0.25
41 0.34
42 0.42
43 0.51
44 0.6
45 0.71
46 0.77
47 0.84
48 0.84
49 0.84
50 0.76
51 0.72
52 0.68
53 0.65
54 0.62
55 0.53
56 0.48
57 0.39
58 0.4
59 0.4
60 0.4
61 0.35