Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6FQ59

Protein Details
Accession A0A5N6FQ59   
Localization Confidence Medium
Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
13-41LEGVTTQKKERKRPRKRFRLRHSDFPKTABasic
NLS Segment(s)
PositionSequence
20-33KKERKRPRKRFRLR
Subcellular Location(s) golg 3, nucl 17, pero 2, plas 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MRTCQDPYVRDLLEGVTTQKKERKRPRKRFRLRHSDFPKTAWTSVDVCHPIRVDRGQTSFFCLLCLNFELLYSAIASNLAYYLYSNNNNNKKPSSRFDRGNRRRLSPLFSFPRMIILPHSEGIGQDSGP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.21
3 0.2
4 0.21
5 0.26
6 0.31
7 0.38
8 0.46
9 0.57
10 0.65
11 0.69
12 0.79
13 0.86
14 0.92
15 0.96
16 0.96
17 0.96
18 0.96
19 0.91
20 0.91
21 0.88
22 0.86
23 0.76
24 0.67
25 0.63
26 0.55
27 0.49
28 0.39
29 0.33
30 0.24
31 0.24
32 0.27
33 0.23
34 0.2
35 0.21
36 0.21
37 0.19
38 0.2
39 0.21
40 0.18
41 0.18
42 0.2
43 0.21
44 0.2
45 0.25
46 0.24
47 0.22
48 0.2
49 0.17
50 0.14
51 0.13
52 0.13
53 0.09
54 0.07
55 0.07
56 0.07
57 0.07
58 0.07
59 0.06
60 0.05
61 0.04
62 0.05
63 0.05
64 0.04
65 0.04
66 0.04
67 0.03
68 0.04
69 0.05
70 0.09
71 0.12
72 0.17
73 0.25
74 0.33
75 0.36
76 0.39
77 0.42
78 0.45
79 0.47
80 0.51
81 0.52
82 0.52
83 0.58
84 0.65
85 0.72
86 0.76
87 0.8
88 0.76
89 0.72
90 0.73
91 0.67
92 0.63
93 0.57
94 0.57
95 0.55
96 0.53
97 0.5
98 0.42
99 0.45
100 0.39
101 0.34
102 0.28
103 0.25
104 0.25
105 0.23
106 0.24
107 0.19
108 0.19
109 0.21