Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6FQ45

Protein Details
Accession A0A5N6FQ45    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
32-51SFLFHNKREKEKRREREAIRBasic
NLS Segment(s)
PositionSequence
39-46REKEKRRE
Subcellular Location(s) plas 17, mito 5, E.R. 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MWPLVLSGIVSQVESFFLYFSFSIFLSLFFLSFLFHNKREKEKRREREAIRSHLPFVVLILIRVISKYAPQDWVCLDNEYG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.08
3 0.06
4 0.06
5 0.08
6 0.08
7 0.08
8 0.08
9 0.07
10 0.09
11 0.09
12 0.09
13 0.09
14 0.09
15 0.09
16 0.08
17 0.08
18 0.07
19 0.07
20 0.11
21 0.13
22 0.16
23 0.21
24 0.24
25 0.33
26 0.43
27 0.53
28 0.59
29 0.66
30 0.73
31 0.76
32 0.83
33 0.78
34 0.79
35 0.77
36 0.73
37 0.69
38 0.61
39 0.53
40 0.45
41 0.41
42 0.3
43 0.22
44 0.19
45 0.13
46 0.11
47 0.1
48 0.1
49 0.09
50 0.1
51 0.1
52 0.06
53 0.09
54 0.12
55 0.14
56 0.2
57 0.21
58 0.24
59 0.26
60 0.29
61 0.29