Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N7C4X1

Protein Details
Accession A0A5N7C4X1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
87-106SSPVFAFHRRHPRQVRPIFDHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 13, plas 12
Family & Domain DBs
Amino Acid Sequences MKAFTILGAAAALCVAPAIAQEDLGRVSILPFPFPSGTPTATPSGTPSTTPLVTPWPTGGSRPTGIVPIPTISWPTPSSSGVPPPYSSPVFAFHRRHPRQVRPIFD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.02
4 0.03
5 0.05
6 0.05
7 0.06
8 0.07
9 0.08
10 0.08
11 0.09
12 0.09
13 0.06
14 0.07
15 0.1
16 0.11
17 0.11
18 0.1
19 0.13
20 0.13
21 0.14
22 0.16
23 0.14
24 0.16
25 0.16
26 0.18
27 0.17
28 0.17
29 0.16
30 0.16
31 0.17
32 0.15
33 0.15
34 0.14
35 0.15
36 0.15
37 0.15
38 0.13
39 0.14
40 0.14
41 0.14
42 0.13
43 0.12
44 0.12
45 0.13
46 0.14
47 0.13
48 0.13
49 0.14
50 0.13
51 0.12
52 0.12
53 0.12
54 0.12
55 0.1
56 0.1
57 0.09
58 0.12
59 0.11
60 0.13
61 0.13
62 0.16
63 0.17
64 0.17
65 0.2
66 0.2
67 0.26
68 0.27
69 0.28
70 0.26
71 0.27
72 0.3
73 0.28
74 0.28
75 0.23
76 0.25
77 0.3
78 0.37
79 0.4
80 0.44
81 0.54
82 0.58
83 0.67
84 0.7
85 0.75
86 0.77