Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6G1S4

Protein Details
Accession A0A5N6G1S4   
Localization Confidence Low
Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
6-33ILHAWLSKLRHHRRTSKKIEQVDPRKSVHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_mito 12.5, mito 22.5, nucl 3
Family & Domain DBs
Amino Acid Sequences MAVGHILHAWLSKLRHHRRTSKKIEQVDPRKSVDFPPSEAPAPLATKSSILESETVSESETEQFGSPLRRVPTPYPFFGTAPSNSGAFTELSDIAKEKAFYPI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.5
3 0.57
4 0.66
5 0.73
6 0.82
7 0.86
8 0.85
9 0.84
10 0.83
11 0.83
12 0.84
13 0.82
14 0.8
15 0.74
16 0.67
17 0.59
18 0.53
19 0.47
20 0.43
21 0.35
22 0.3
23 0.29
24 0.28
25 0.27
26 0.26
27 0.24
28 0.19
29 0.18
30 0.16
31 0.13
32 0.11
33 0.11
34 0.11
35 0.11
36 0.09
37 0.08
38 0.09
39 0.08
40 0.09
41 0.09
42 0.09
43 0.08
44 0.08
45 0.08
46 0.08
47 0.08
48 0.07
49 0.07
50 0.07
51 0.08
52 0.11
53 0.11
54 0.15
55 0.17
56 0.18
57 0.22
58 0.25
59 0.34
60 0.36
61 0.38
62 0.38
63 0.38
64 0.37
65 0.36
66 0.35
67 0.26
68 0.25
69 0.24
70 0.19
71 0.17
72 0.17
73 0.15
74 0.12
75 0.11
76 0.11
77 0.11
78 0.12
79 0.13
80 0.14
81 0.14
82 0.16
83 0.17