Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5J5ERK3

Protein Details
Accession A0A5J5ERK3   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
119-141QKYLETKEKRKIKKKDVNPQSVLHydrophilic
NLS Segment(s)
PositionSequence
126-133EKRKIKKK
Subcellular Location(s) cyto 4, cyto_mito 13, mito 20
Family & Domain DBs
InterPro View protein in InterPro  
IPR029427  AIM23  
IPR036788  T_IF-3_C_sf  
IPR036787  T_IF-3_N_sf  
IPR001288  Translation_initiation_fac_3  
IPR019815  Translation_initiation_fac_3_C  
Gene Ontology GO:0003743  F:translation initiation factor activity  
Pfam View protein in Pfam  
PF00707  IF3_C  
PF14877  mIF3  
Amino Acid Sequences MPPPLLSPILRALSIGLRPTATLPRRVAAPSTFMRAYRTPVPIHTPVPTRVVDEAIPRDTVNYIDAAGKFHANGSVSEILRSLDRQKWTLVCINPTADEDIPLVCRVNSKEELAERDHQKYLETKEKRKIKKKDVNPQSVLKEIEISWAISEHDLQHRMKKAREFLGKGYRLNITIGVKKGMAKQTLIDAMALLERVEGEVLQCGRERAEPEGHVGKRYVMRLEGKRRREGAEEGAEEGEAEEAEEGSEEKPKEEAEEGTEGRPIEEAEGVAEERPKEAEAAQL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.24
3 0.19
4 0.17
5 0.18
6 0.2
7 0.28
8 0.27
9 0.32
10 0.32
11 0.33
12 0.36
13 0.37
14 0.38
15 0.3
16 0.32
17 0.28
18 0.32
19 0.32
20 0.3
21 0.33
22 0.31
23 0.35
24 0.35
25 0.37
26 0.32
27 0.34
28 0.4
29 0.39
30 0.4
31 0.39
32 0.37
33 0.36
34 0.38
35 0.35
36 0.31
37 0.27
38 0.27
39 0.24
40 0.24
41 0.25
42 0.23
43 0.23
44 0.21
45 0.2
46 0.19
47 0.18
48 0.14
49 0.1
50 0.09
51 0.12
52 0.12
53 0.13
54 0.13
55 0.13
56 0.12
57 0.12
58 0.14
59 0.11
60 0.11
61 0.14
62 0.19
63 0.18
64 0.18
65 0.18
66 0.17
67 0.16
68 0.18
69 0.18
70 0.18
71 0.2
72 0.21
73 0.24
74 0.24
75 0.27
76 0.32
77 0.29
78 0.27
79 0.26
80 0.26
81 0.24
82 0.24
83 0.23
84 0.16
85 0.15
86 0.13
87 0.11
88 0.11
89 0.11
90 0.1
91 0.08
92 0.1
93 0.11
94 0.15
95 0.17
96 0.16
97 0.18
98 0.2
99 0.23
100 0.24
101 0.3
102 0.28
103 0.29
104 0.29
105 0.27
106 0.26
107 0.27
108 0.29
109 0.32
110 0.35
111 0.38
112 0.46
113 0.55
114 0.63
115 0.69
116 0.73
117 0.74
118 0.78
119 0.82
120 0.84
121 0.85
122 0.84
123 0.78
124 0.73
125 0.64
126 0.57
127 0.48
128 0.37
129 0.28
130 0.19
131 0.17
132 0.13
133 0.11
134 0.07
135 0.07
136 0.08
137 0.07
138 0.07
139 0.07
140 0.1
141 0.13
142 0.14
143 0.19
144 0.25
145 0.28
146 0.31
147 0.34
148 0.36
149 0.4
150 0.46
151 0.44
152 0.44
153 0.5
154 0.5
155 0.46
156 0.43
157 0.36
158 0.3
159 0.28
160 0.25
161 0.18
162 0.19
163 0.19
164 0.18
165 0.18
166 0.19
167 0.23
168 0.25
169 0.23
170 0.2
171 0.2
172 0.21
173 0.23
174 0.21
175 0.16
176 0.11
177 0.1
178 0.1
179 0.09
180 0.06
181 0.04
182 0.04
183 0.04
184 0.04
185 0.04
186 0.04
187 0.07
188 0.07
189 0.09
190 0.09
191 0.1
192 0.11
193 0.14
194 0.15
195 0.16
196 0.2
197 0.19
198 0.24
199 0.32
200 0.31
201 0.31
202 0.3
203 0.29
204 0.29
205 0.31
206 0.27
207 0.24
208 0.31
209 0.38
210 0.48
211 0.54
212 0.57
213 0.62
214 0.63
215 0.61
216 0.58
217 0.53
218 0.5
219 0.48
220 0.43
221 0.38
222 0.35
223 0.31
224 0.27
225 0.23
226 0.15
227 0.07
228 0.06
229 0.04
230 0.04
231 0.04
232 0.05
233 0.05
234 0.06
235 0.12
236 0.12
237 0.12
238 0.14
239 0.14
240 0.17
241 0.18
242 0.19
243 0.18
244 0.24
245 0.25
246 0.25
247 0.27
248 0.24
249 0.22
250 0.22
251 0.18
252 0.13
253 0.12
254 0.11
255 0.1
256 0.11
257 0.12
258 0.13
259 0.15
260 0.14
261 0.14
262 0.15
263 0.15
264 0.14