Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H1VHE7

Protein Details
Accession H1VHE7   
Localization Confidence Medium
Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
40-71WMKAPHRDGDRPRRRRRRRSRHEGRRCREPGLBasic
NLS Segment(s)
PositionSequence
45-79HRDGDRPRRRRRRRSRHEGRRCREPGLSPRLLIRK
Subcellular Location(s) nucl 12, mito 10, cyto 3
Family & Domain DBs
Amino Acid Sequences GAPDTNISSILTNFFPKQKTQHPPSEFREGNYGFISGLVWMKAPHRDGDRPRRRRRRRSRHEGRRCREPGLSPRLLIRKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.22
3 0.24
4 0.3
5 0.36
6 0.44
7 0.48
8 0.56
9 0.57
10 0.63
11 0.65
12 0.69
13 0.61
14 0.52
15 0.52
16 0.43
17 0.39
18 0.32
19 0.27
20 0.17
21 0.16
22 0.15
23 0.08
24 0.08
25 0.05
26 0.05
27 0.05
28 0.07
29 0.09
30 0.1
31 0.12
32 0.16
33 0.23
34 0.31
35 0.42
36 0.52
37 0.6
38 0.7
39 0.79
40 0.86
41 0.91
42 0.94
43 0.94
44 0.94
45 0.95
46 0.96
47 0.96
48 0.97
49 0.96
50 0.92
51 0.91
52 0.83
53 0.76
54 0.69
55 0.66
56 0.64
57 0.62
58 0.58
59 0.48
60 0.53