Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5J5F4P4

Protein Details
Accession A0A5J5F4P4   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
17-44WKIPWRMSAPQKYRQRKRLQRIDRLVNCHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 3.5, cyto_mito 13.5, mito 22.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGAFRPSQPLLGGLLWKIPWRMSAPQKYRQRKRLQRIDRLVNCVDNALKKQGMTVAAIEEWKASMPTEAEMEPRDKYTIFARNERGYRKGGHKVPKWTRVSQRVNPPGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.15
3 0.15
4 0.16
5 0.16
6 0.14
7 0.15
8 0.18
9 0.26
10 0.33
11 0.42
12 0.47
13 0.56
14 0.65
15 0.74
16 0.79
17 0.81
18 0.83
19 0.83
20 0.87
21 0.89
22 0.88
23 0.87
24 0.86
25 0.87
26 0.8
27 0.75
28 0.66
29 0.56
30 0.46
31 0.36
32 0.29
33 0.2
34 0.18
35 0.15
36 0.14
37 0.12
38 0.13
39 0.13
40 0.13
41 0.12
42 0.1
43 0.08
44 0.08
45 0.08
46 0.08
47 0.06
48 0.05
49 0.05
50 0.05
51 0.04
52 0.05
53 0.05
54 0.06
55 0.08
56 0.08
57 0.09
58 0.1
59 0.12
60 0.12
61 0.13
62 0.14
63 0.12
64 0.13
65 0.18
66 0.24
67 0.27
68 0.32
69 0.36
70 0.42
71 0.47
72 0.5
73 0.48
74 0.43
75 0.44
76 0.46
77 0.49
78 0.5
79 0.55
80 0.58
81 0.66
82 0.72
83 0.77
84 0.76
85 0.75
86 0.77
87 0.78
88 0.8
89 0.77
90 0.79