Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5J5F6R0

Protein Details
Accession A0A5J5F6R0   
Localization Confidence Medium
Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
63-91ASDANCRRAKRRKQKAKRRIARKATPAIKHydrophilic
NLS Segment(s)
PositionSequence
69-86RRAKRRKQKAKRRIARKA
Subcellular Location(s) cyto_nucl 8.5, mito 12, nucl 13
Family & Domain DBs
Amino Acid Sequences MAIKALGNRHSLVPLSSPTRIPFRQQTATCLHSTDLNPRRSVRRASRAATAEITPLYTVEKIASDANCRRAKRRKQKAKRRIARKATPAIKNTVTTSNSVPTSSHGDDDVSTDDEMDFDDIPSYFSHFGSEGGRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.24
3 0.24
4 0.25
5 0.26
6 0.33
7 0.33
8 0.36
9 0.39
10 0.42
11 0.49
12 0.48
13 0.5
14 0.48
15 0.5
16 0.44
17 0.37
18 0.31
19 0.26
20 0.26
21 0.32
22 0.34
23 0.34
24 0.36
25 0.38
26 0.43
27 0.43
28 0.51
29 0.49
30 0.51
31 0.53
32 0.53
33 0.57
34 0.54
35 0.51
36 0.45
37 0.36
38 0.27
39 0.21
40 0.19
41 0.12
42 0.1
43 0.09
44 0.07
45 0.07
46 0.06
47 0.06
48 0.07
49 0.09
50 0.09
51 0.13
52 0.15
53 0.24
54 0.29
55 0.29
56 0.36
57 0.44
58 0.54
59 0.6
60 0.69
61 0.72
62 0.78
63 0.89
64 0.92
65 0.94
66 0.93
67 0.92
68 0.92
69 0.9
70 0.87
71 0.83
72 0.82
73 0.79
74 0.76
75 0.67
76 0.62
77 0.54
78 0.47
79 0.42
80 0.38
81 0.31
82 0.27
83 0.26
84 0.25
85 0.24
86 0.23
87 0.2
88 0.17
89 0.23
90 0.22
91 0.21
92 0.18
93 0.18
94 0.17
95 0.19
96 0.19
97 0.14
98 0.13
99 0.12
100 0.12
101 0.11
102 0.11
103 0.11
104 0.09
105 0.07
106 0.08
107 0.08
108 0.09
109 0.1
110 0.13
111 0.12
112 0.12
113 0.14
114 0.13
115 0.15