Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5J5EW41

Protein Details
Accession A0A5J5EW41   
Localization Confidence Medium
Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
81-110STPRTLPSPTRQRKPRQKKLHDTVKKRGMTHydrophilic
NLS Segment(s)
PositionSequence
90-133TRQRKPRQKKLHDTVKKRGMTGAELAEKAAKKQATAKTRPGAPP
Subcellular Location(s) cyto_mito 9.5, mito 15.5, nucl 9
Family & Domain DBs
Amino Acid Sequences MPAPFVLLQRRELKCLFLKPPSGRTAFTHQGELMVSRALYPGALHHQSLSGEDAEWCDERLHDAIREAATTFPAPGPGEPSTPRTLPSPTRQRKPRQKKLHDTVKKRGMTGAELAEKAAKKQATAKTRPGAPPKNSGGQTDTAAESRSQGQRRSGRGPLVSIKHPSDGAVGNGGGGGRRATTEMIIWMDYYVQYLTFYTLFQTLNSMFQSQIFGAERGQDVRTLSRESARQSDFGLCRDIPHLGRARLASLTQTQKPRVRLEPAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.49
3 0.49
4 0.46
5 0.53
6 0.53
7 0.58
8 0.59
9 0.55
10 0.5
11 0.49
12 0.51
13 0.5
14 0.47
15 0.44
16 0.37
17 0.36
18 0.34
19 0.3
20 0.22
21 0.15
22 0.13
23 0.1
24 0.1
25 0.09
26 0.08
27 0.07
28 0.09
29 0.15
30 0.17
31 0.17
32 0.17
33 0.19
34 0.19
35 0.2
36 0.19
37 0.13
38 0.11
39 0.11
40 0.12
41 0.13
42 0.13
43 0.13
44 0.11
45 0.1
46 0.12
47 0.14
48 0.14
49 0.13
50 0.14
51 0.15
52 0.15
53 0.16
54 0.14
55 0.13
56 0.13
57 0.12
58 0.12
59 0.09
60 0.11
61 0.11
62 0.11
63 0.15
64 0.14
65 0.16
66 0.17
67 0.21
68 0.23
69 0.22
70 0.23
71 0.21
72 0.24
73 0.27
74 0.35
75 0.42
76 0.47
77 0.56
78 0.63
79 0.72
80 0.79
81 0.85
82 0.87
83 0.87
84 0.89
85 0.9
86 0.91
87 0.92
88 0.9
89 0.86
90 0.85
91 0.83
92 0.74
93 0.63
94 0.56
95 0.45
96 0.38
97 0.32
98 0.26
99 0.19
100 0.17
101 0.17
102 0.18
103 0.16
104 0.15
105 0.17
106 0.13
107 0.12
108 0.19
109 0.25
110 0.31
111 0.36
112 0.41
113 0.41
114 0.45
115 0.5
116 0.52
117 0.53
118 0.47
119 0.49
120 0.46
121 0.48
122 0.44
123 0.4
124 0.34
125 0.27
126 0.26
127 0.2
128 0.18
129 0.13
130 0.13
131 0.11
132 0.1
133 0.13
134 0.18
135 0.2
136 0.21
137 0.28
138 0.34
139 0.38
140 0.42
141 0.41
142 0.39
143 0.37
144 0.38
145 0.36
146 0.33
147 0.32
148 0.31
149 0.28
150 0.26
151 0.25
152 0.22
153 0.19
154 0.16
155 0.14
156 0.11
157 0.1
158 0.08
159 0.09
160 0.08
161 0.06
162 0.06
163 0.05
164 0.04
165 0.05
166 0.06
167 0.06
168 0.07
169 0.07
170 0.08
171 0.09
172 0.09
173 0.09
174 0.08
175 0.08
176 0.08
177 0.08
178 0.06
179 0.06
180 0.06
181 0.06
182 0.08
183 0.08
184 0.08
185 0.08
186 0.11
187 0.11
188 0.1
189 0.13
190 0.12
191 0.15
192 0.16
193 0.16
194 0.13
195 0.13
196 0.15
197 0.12
198 0.16
199 0.15
200 0.14
201 0.14
202 0.16
203 0.17
204 0.17
205 0.17
206 0.15
207 0.15
208 0.18
209 0.21
210 0.22
211 0.23
212 0.25
213 0.28
214 0.31
215 0.37
216 0.35
217 0.33
218 0.32
219 0.39
220 0.36
221 0.34
222 0.35
223 0.27
224 0.27
225 0.28
226 0.3
227 0.23
228 0.29
229 0.34
230 0.3
231 0.34
232 0.33
233 0.34
234 0.31
235 0.31
236 0.27
237 0.27
238 0.33
239 0.36
240 0.43
241 0.49
242 0.53
243 0.58
244 0.61
245 0.6