Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5J5EXJ1

Protein Details
Accession A0A5J5EXJ1   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MKRARVWKKIKSRNHCSACCWHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR011009  Kinase-like_dom_sf  
IPR000719  Prot_kinase_dom  
Gene Ontology GO:0005524  F:ATP binding  
GO:0004672  F:protein kinase activity  
GO:0006468  P:protein phosphorylation  
PROSITE View protein in PROSITE  
PS50011  PROTEIN_KINASE_DOM  
Amino Acid Sequences MKRARVWKKIKSRNHCSACCWSSSPMRPRYFHAPERLARRPELVTDVLAALSMVHSAGVLHQDDMPRNILIDGNDGVWWVDFGSALTTVYNQIHPNWFEGERRRVKELLTKDVIPAELEGRVPTWRIRGW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.81
3 0.76
4 0.75
5 0.67
6 0.6
7 0.52
8 0.46
9 0.44
10 0.5
11 0.53
12 0.52
13 0.56
14 0.54
15 0.57
16 0.62
17 0.62
18 0.59
19 0.58
20 0.56
21 0.55
22 0.61
23 0.64
24 0.57
25 0.5
26 0.47
27 0.39
28 0.34
29 0.33
30 0.26
31 0.18
32 0.16
33 0.15
34 0.12
35 0.11
36 0.09
37 0.05
38 0.04
39 0.04
40 0.03
41 0.02
42 0.02
43 0.02
44 0.03
45 0.05
46 0.05
47 0.06
48 0.07
49 0.08
50 0.09
51 0.1
52 0.12
53 0.1
54 0.1
55 0.09
56 0.09
57 0.08
58 0.1
59 0.09
60 0.08
61 0.08
62 0.08
63 0.07
64 0.06
65 0.06
66 0.04
67 0.04
68 0.03
69 0.03
70 0.04
71 0.05
72 0.05
73 0.05
74 0.05
75 0.07
76 0.08
77 0.11
78 0.11
79 0.12
80 0.16
81 0.17
82 0.19
83 0.2
84 0.21
85 0.24
86 0.3
87 0.38
88 0.42
89 0.45
90 0.48
91 0.45
92 0.46
93 0.49
94 0.48
95 0.47
96 0.43
97 0.4
98 0.37
99 0.39
100 0.37
101 0.29
102 0.25
103 0.17
104 0.13
105 0.13
106 0.13
107 0.12
108 0.13
109 0.14
110 0.16