Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5J5EWI2

Protein Details
Accession A0A5J5EWI2   
Localization Confidence High
Confidence Score 18.4
NoLS Segment(s)
PositionSequenceProtein Nature
287-339RRRDDGRGRRRDEDRDRRRDGDSWDRKRNRTRSRPRDRERDRVDRRHKDVEYCBasic
NLS Segment(s)
PositionSequence
203-213AARAEKRERAR
256-333RAAPPPPSRDRGSRRSSRWDEGDRRRDDDRDRRRDDGRGRRRDEDRDRRRDGDSWDRKRNRTRSRPRDRERDRVDRRH
Subcellular Location(s) cyto 4, nucl 21
Family & Domain DBs
InterPro View protein in InterPro  
IPR012479  SAP30BP  
Gene Ontology GO:0006355  P:regulation of DNA-templated transcription  
Pfam View protein in Pfam  
PF07818  HCNGP  
Amino Acid Sequences MELDYGSDSEEEEKKDFEAPSAPQAPPPIPPAKQEPPHEQPTKPFIPASDTIVVPAKEPEQPPSNDAPIVGPQRPPTASPEPEDDEDPANPPLSPYSLERTLVHNLTLPPTIPAIPPSPPGSPPPPLSAKFSHFRDLKSNGVHFNEKLLRSSSLRNPNLLQKLTAFVGFDEMDQYATNLSKDVWDPKGFKKDEFVEELAKKQAARAEKRERARLEGAREKVEFVGSVQTPPAQQPRERVAESAAERVMKGLDRESRAAPPPPSRDRGSRRSSRWDEGDRRRDDDRDRRRDDGRGRRRDEDRDRRRDGDSWDRKRNRTRSRPRDRERDRVDRRHKDVEYCDRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.25
3 0.25
4 0.22
5 0.24
6 0.23
7 0.3
8 0.34
9 0.34
10 0.31
11 0.35
12 0.34
13 0.32
14 0.35
15 0.34
16 0.3
17 0.34
18 0.4
19 0.46
20 0.52
21 0.56
22 0.59
23 0.59
24 0.68
25 0.68
26 0.62
27 0.59
28 0.6
29 0.57
30 0.5
31 0.43
32 0.34
33 0.36
34 0.35
35 0.35
36 0.3
37 0.26
38 0.25
39 0.3
40 0.29
41 0.23
42 0.23
43 0.19
44 0.21
45 0.22
46 0.26
47 0.28
48 0.29
49 0.33
50 0.36
51 0.36
52 0.31
53 0.31
54 0.27
55 0.27
56 0.3
57 0.27
58 0.25
59 0.25
60 0.29
61 0.29
62 0.29
63 0.3
64 0.33
65 0.33
66 0.33
67 0.36
68 0.36
69 0.37
70 0.37
71 0.31
72 0.26
73 0.24
74 0.23
75 0.19
76 0.16
77 0.14
78 0.13
79 0.12
80 0.11
81 0.13
82 0.13
83 0.17
84 0.19
85 0.21
86 0.22
87 0.25
88 0.28
89 0.27
90 0.25
91 0.22
92 0.21
93 0.21
94 0.21
95 0.17
96 0.13
97 0.13
98 0.14
99 0.11
100 0.13
101 0.12
102 0.13
103 0.15
104 0.18
105 0.18
106 0.18
107 0.22
108 0.23
109 0.25
110 0.26
111 0.28
112 0.3
113 0.3
114 0.33
115 0.32
116 0.33
117 0.36
118 0.36
119 0.4
120 0.37
121 0.37
122 0.39
123 0.39
124 0.39
125 0.36
126 0.36
127 0.31
128 0.32
129 0.33
130 0.27
131 0.28
132 0.28
133 0.25
134 0.24
135 0.23
136 0.22
137 0.22
138 0.26
139 0.29
140 0.35
141 0.35
142 0.35
143 0.35
144 0.4
145 0.43
146 0.38
147 0.31
148 0.21
149 0.22
150 0.21
151 0.19
152 0.13
153 0.08
154 0.09
155 0.09
156 0.08
157 0.07
158 0.07
159 0.07
160 0.06
161 0.07
162 0.05
163 0.05
164 0.06
165 0.05
166 0.05
167 0.06
168 0.07
169 0.11
170 0.13
171 0.16
172 0.19
173 0.24
174 0.33
175 0.33
176 0.32
177 0.33
178 0.34
179 0.33
180 0.34
181 0.31
182 0.28
183 0.28
184 0.29
185 0.26
186 0.23
187 0.2
188 0.17
189 0.19
190 0.21
191 0.25
192 0.33
193 0.41
194 0.48
195 0.53
196 0.59
197 0.57
198 0.55
199 0.57
200 0.52
201 0.5
202 0.5
203 0.48
204 0.44
205 0.43
206 0.38
207 0.32
208 0.28
209 0.2
210 0.13
211 0.16
212 0.12
213 0.13
214 0.12
215 0.13
216 0.13
217 0.16
218 0.22
219 0.2
220 0.21
221 0.26
222 0.32
223 0.36
224 0.36
225 0.34
226 0.29
227 0.32
228 0.32
229 0.3
230 0.25
231 0.2
232 0.19
233 0.19
234 0.18
235 0.13
236 0.13
237 0.14
238 0.19
239 0.21
240 0.24
241 0.26
242 0.29
243 0.32
244 0.36
245 0.36
246 0.37
247 0.42
248 0.46
249 0.49
250 0.49
251 0.55
252 0.58
253 0.62
254 0.64
255 0.66
256 0.65
257 0.71
258 0.73
259 0.7
260 0.7
261 0.7
262 0.71
263 0.73
264 0.77
265 0.7
266 0.68
267 0.65
268 0.62
269 0.62
270 0.63
271 0.63
272 0.64
273 0.66
274 0.67
275 0.67
276 0.71
277 0.72
278 0.72
279 0.72
280 0.72
281 0.72
282 0.75
283 0.77
284 0.79
285 0.8
286 0.8
287 0.8
288 0.79
289 0.8
290 0.76
291 0.74
292 0.68
293 0.65
294 0.65
295 0.65
296 0.65
297 0.69
298 0.74
299 0.78
300 0.83
301 0.86
302 0.86
303 0.86
304 0.88
305 0.88
306 0.92
307 0.95
308 0.94
309 0.94
310 0.91
311 0.91
312 0.89
313 0.89
314 0.88
315 0.88
316 0.89
317 0.88
318 0.88
319 0.87
320 0.81
321 0.78
322 0.77