Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5J5EGI9

Protein Details
Accession A0A5J5EGI9    Localization Confidence Low Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
42-71IGARSCQNAKRNSRRWRVKRPPYWRNITVGHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 11, mito 10, nucl 3, cyto 2
Family & Domain DBs
Amino Acid Sequences MEMTAAAAFRPSLTATWQWGKETMVLLLLLLMTFWSRWQASIGARSCQNAKRNSRRWRVKRPPYWRNITVGNG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.18
3 0.24
4 0.25
5 0.25
6 0.26
7 0.26
8 0.24
9 0.22
10 0.17
11 0.12
12 0.11
13 0.09
14 0.08
15 0.07
16 0.05
17 0.04
18 0.03
19 0.03
20 0.03
21 0.03
22 0.05
23 0.05
24 0.06
25 0.07
26 0.09
27 0.11
28 0.18
29 0.2
30 0.2
31 0.21
32 0.22
33 0.25
34 0.29
35 0.34
36 0.35
37 0.44
38 0.52
39 0.61
40 0.7
41 0.77
42 0.83
43 0.86
44 0.89
45 0.9
46 0.91
47 0.92
48 0.92
49 0.92
50 0.9
51 0.9
52 0.82
53 0.75