Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5J5F2Y4

Protein Details
Accession A0A5J5F2Y4    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
246-272STLKVEVKKTARRKRAVNRKGKVSNVHHydrophilic
NLS Segment(s)
PositionSequence
253-267KKTARRKRAVNRKGK
Subcellular Location(s) mito 20, nucl 4, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR040501  TFA2_Winged_2  
IPR016656  TFIIE-bsu  
IPR003166  TFIIE_bsu_DNA-bd  
Gene Ontology GO:0005673  C:transcription factor TFIIE complex  
GO:0003677  F:DNA binding  
GO:0006367  P:transcription initiation at RNA polymerase II promoter  
Pfam View protein in Pfam  
PF18121  TFA2_Winged_2  
PF02186  TFIIE_beta  
PROSITE View protein in PROSITE  
PS51351  TFIIE_BETA_C  
Amino Acid Sequences MSLQRSADAFKSSLTSAANLFPSRPKPVNNPPPPPPPTSNNNGASTTKRKRIVTPATAPAAQVYTQPSLSTLGGQHLMTQVVHAQQYLKEKERALRISEVASYLSLPLTSEVFTVLKENKNPRIYYSAENDTLEFRPLHNIRSKTDLLAFLQRQSTALGLPVKELKEGWAGAIDAIDTLEASGEILVLRTKKENQPRIIWGNDKSLNSDVDAEFGGMWFGIKIPPAMELVGDLERKGMRSATVDLSTLKVEVKKTARRKRAVNRKGKVSNVHMSDILKDSKDLRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.18
3 0.16
4 0.19
5 0.23
6 0.21
7 0.22
8 0.26
9 0.29
10 0.35
11 0.37
12 0.39
13 0.43
14 0.54
15 0.63
16 0.66
17 0.7
18 0.69
19 0.75
20 0.75
21 0.73
22 0.67
23 0.61
24 0.58
25 0.57
26 0.58
27 0.54
28 0.53
29 0.49
30 0.46
31 0.47
32 0.51
33 0.52
34 0.51
35 0.53
36 0.52
37 0.54
38 0.61
39 0.64
40 0.63
41 0.62
42 0.61
43 0.58
44 0.56
45 0.51
46 0.41
47 0.33
48 0.24
49 0.2
50 0.17
51 0.14
52 0.14
53 0.14
54 0.14
55 0.15
56 0.15
57 0.14
58 0.12
59 0.12
60 0.14
61 0.14
62 0.14
63 0.12
64 0.13
65 0.11
66 0.11
67 0.11
68 0.1
69 0.11
70 0.1
71 0.1
72 0.12
73 0.2
74 0.24
75 0.27
76 0.28
77 0.29
78 0.34
79 0.4
80 0.4
81 0.36
82 0.35
83 0.32
84 0.3
85 0.29
86 0.25
87 0.18
88 0.15
89 0.11
90 0.09
91 0.08
92 0.06
93 0.06
94 0.06
95 0.06
96 0.06
97 0.06
98 0.07
99 0.07
100 0.07
101 0.09
102 0.12
103 0.14
104 0.19
105 0.24
106 0.3
107 0.35
108 0.35
109 0.35
110 0.36
111 0.36
112 0.35
113 0.35
114 0.31
115 0.28
116 0.28
117 0.26
118 0.24
119 0.22
120 0.2
121 0.15
122 0.11
123 0.17
124 0.17
125 0.2
126 0.24
127 0.25
128 0.25
129 0.3
130 0.31
131 0.24
132 0.25
133 0.23
134 0.19
135 0.23
136 0.22
137 0.18
138 0.18
139 0.17
140 0.16
141 0.15
142 0.14
143 0.08
144 0.1
145 0.1
146 0.09
147 0.1
148 0.13
149 0.13
150 0.13
151 0.13
152 0.11
153 0.12
154 0.12
155 0.11
156 0.09
157 0.08
158 0.08
159 0.08
160 0.06
161 0.04
162 0.04
163 0.04
164 0.03
165 0.02
166 0.02
167 0.02
168 0.02
169 0.02
170 0.03
171 0.03
172 0.03
173 0.05
174 0.06
175 0.07
176 0.1
177 0.15
178 0.22
179 0.32
180 0.4
181 0.43
182 0.48
183 0.53
184 0.55
185 0.55
186 0.52
187 0.45
188 0.44
189 0.44
190 0.39
191 0.35
192 0.32
193 0.29
194 0.25
195 0.26
196 0.18
197 0.15
198 0.14
199 0.12
200 0.09
201 0.09
202 0.08
203 0.05
204 0.05
205 0.04
206 0.04
207 0.05
208 0.05
209 0.06
210 0.06
211 0.07
212 0.08
213 0.08
214 0.08
215 0.08
216 0.1
217 0.12
218 0.13
219 0.11
220 0.13
221 0.14
222 0.15
223 0.16
224 0.14
225 0.12
226 0.15
227 0.19
228 0.21
229 0.22
230 0.22
231 0.21
232 0.22
233 0.21
234 0.19
235 0.18
236 0.16
237 0.16
238 0.23
239 0.3
240 0.38
241 0.48
242 0.58
243 0.66
244 0.7
245 0.79
246 0.83
247 0.86
248 0.87
249 0.87
250 0.85
251 0.86
252 0.86
253 0.82
254 0.79
255 0.75
256 0.74
257 0.67
258 0.62
259 0.54
260 0.47
261 0.43
262 0.4
263 0.36
264 0.27
265 0.25