Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5J5EC35

Protein Details
Accession A0A5J5EC35    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
128-148NSRSREWPEKTTRSRKRKTGEBasic
168-192QGQKGGISKKPKKTGGKKSSGPTGRBasic
NLS Segment(s)
PositionSequence
137-189KTTRSRKRKTGEQIGGGGKPQSKDAGKKRPAQGQKGGISKKPKKTGGKKSSGP
Subcellular Location(s) nucl 14, mito 10, cyto_nucl 9.5
Family & Domain DBs
Amino Acid Sequences MLAHPRGSLDPRTNVPSLRLVPEGGAKPPRTIKRRGSNPIEISRLGMQPGSLPGSLSITRNRDCVELEKALKKLSIKKAATQVEEDAYDSIKARDAVLDERVRAAVQSALAKQSESFDTFTVEGEPTNSRSREWPEKTTRSRKRKTGEQIGGGGKPQSKDAGKKRPAQGQKGGISKKPKKTGGKKSSGPTGRSAAAQSLRNF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.39
3 0.39
4 0.36
5 0.34
6 0.31
7 0.26
8 0.26
9 0.31
10 0.3
11 0.28
12 0.32
13 0.3
14 0.33
15 0.41
16 0.49
17 0.48
18 0.54
19 0.59
20 0.62
21 0.71
22 0.76
23 0.75
24 0.76
25 0.77
26 0.75
27 0.69
28 0.58
29 0.51
30 0.45
31 0.38
32 0.29
33 0.22
34 0.16
35 0.13
36 0.15
37 0.14
38 0.11
39 0.11
40 0.1
41 0.14
42 0.15
43 0.16
44 0.19
45 0.22
46 0.23
47 0.24
48 0.25
49 0.22
50 0.23
51 0.25
52 0.24
53 0.24
54 0.27
55 0.29
56 0.29
57 0.28
58 0.29
59 0.28
60 0.31
61 0.35
62 0.41
63 0.38
64 0.41
65 0.49
66 0.51
67 0.5
68 0.43
69 0.36
70 0.27
71 0.26
72 0.22
73 0.14
74 0.11
75 0.1
76 0.09
77 0.08
78 0.08
79 0.08
80 0.07
81 0.08
82 0.09
83 0.1
84 0.14
85 0.15
86 0.14
87 0.14
88 0.14
89 0.13
90 0.12
91 0.1
92 0.06
93 0.06
94 0.08
95 0.08
96 0.1
97 0.1
98 0.1
99 0.1
100 0.1
101 0.11
102 0.11
103 0.11
104 0.1
105 0.12
106 0.12
107 0.12
108 0.12
109 0.1
110 0.08
111 0.09
112 0.1
113 0.12
114 0.16
115 0.16
116 0.16
117 0.19
118 0.26
119 0.34
120 0.38
121 0.43
122 0.47
123 0.56
124 0.65
125 0.73
126 0.77
127 0.78
128 0.81
129 0.81
130 0.79
131 0.79
132 0.8
133 0.8
134 0.76
135 0.69
136 0.67
137 0.61
138 0.55
139 0.46
140 0.39
141 0.3
142 0.24
143 0.21
144 0.21
145 0.22
146 0.3
147 0.38
148 0.47
149 0.51
150 0.59
151 0.64
152 0.69
153 0.74
154 0.72
155 0.71
156 0.69
157 0.68
158 0.69
159 0.67
160 0.63
161 0.65
162 0.67
163 0.68
164 0.69
165 0.71
166 0.73
167 0.8
168 0.85
169 0.85
170 0.86
171 0.83
172 0.8
173 0.82
174 0.78
175 0.7
176 0.63
177 0.57
178 0.49
179 0.44
180 0.4
181 0.36
182 0.34