Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5J5EMV7

Protein Details
Accession A0A5J5EMV7    Localization Confidence Medium Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
176-197VDKAEGKKRKPKKKTEGEAAAEBasic
NLS Segment(s)
PositionSequence
75-79GKGKR
112-117KKRKKK
165-202GRRKAVGIKSAVDKAEGKKRKPKKKTEGEAAAEPKAEK
Subcellular Location(s) nucl 13, cyto_nucl 10.833, mito_nucl 9.833, cyto 7.5, mito 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036249  Thioredoxin-like_sf  
Amino Acid Sequences MATAPSEAPQTFDPQAFDRDEEDTIFLLTSLTSGSSSIITATSRLEHILKSNKVPFKAVDLATDDKARRLWQWKGKGKRLPGIAKNGNVLGNFEDIEEWNEYGELRQNLGLKKRKKKINVMDGDTAHSKPSRTATPNVVQPKAPKSDLPAGGVPTAIAQAAAAAGRRKAVGIKSAVDKAEGKKRKPKKKTEGEAAAEPKAEKTAETKAERPAEPEAAKAPEEETKAAAPQAENKEEEPKAALPEAENKEEAPVPEKKDEEAKIEEFESKAEEAVPETKEKATPTEAKSVESAEKKPDEAPTEEAAVSELKSNVEALDLQDKNEALVPGDEESKTPTQTPATKEGEEEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.29
3 0.29
4 0.29
5 0.25
6 0.25
7 0.24
8 0.23
9 0.21
10 0.17
11 0.16
12 0.14
13 0.12
14 0.09
15 0.08
16 0.07
17 0.06
18 0.06
19 0.06
20 0.06
21 0.07
22 0.07
23 0.07
24 0.08
25 0.08
26 0.08
27 0.09
28 0.1
29 0.11
30 0.11
31 0.14
32 0.14
33 0.14
34 0.21
35 0.29
36 0.31
37 0.37
38 0.44
39 0.47
40 0.47
41 0.49
42 0.43
43 0.4
44 0.44
45 0.37
46 0.32
47 0.31
48 0.33
49 0.32
50 0.37
51 0.3
52 0.25
53 0.27
54 0.26
55 0.27
56 0.3
57 0.38
58 0.42
59 0.52
60 0.6
61 0.68
62 0.76
63 0.77
64 0.76
65 0.73
66 0.72
67 0.71
68 0.67
69 0.67
70 0.63
71 0.58
72 0.54
73 0.49
74 0.42
75 0.33
76 0.29
77 0.2
78 0.16
79 0.14
80 0.12
81 0.11
82 0.09
83 0.11
84 0.11
85 0.1
86 0.09
87 0.09
88 0.09
89 0.09
90 0.14
91 0.12
92 0.12
93 0.14
94 0.18
95 0.22
96 0.3
97 0.38
98 0.42
99 0.51
100 0.59
101 0.65
102 0.69
103 0.76
104 0.77
105 0.79
106 0.78
107 0.74
108 0.71
109 0.64
110 0.59
111 0.51
112 0.41
113 0.31
114 0.24
115 0.19
116 0.15
117 0.18
118 0.21
119 0.23
120 0.26
121 0.31
122 0.34
123 0.4
124 0.43
125 0.41
126 0.36
127 0.36
128 0.37
129 0.35
130 0.32
131 0.25
132 0.25
133 0.32
134 0.32
135 0.31
136 0.28
137 0.25
138 0.24
139 0.23
140 0.18
141 0.1
142 0.09
143 0.06
144 0.04
145 0.03
146 0.03
147 0.03
148 0.03
149 0.04
150 0.05
151 0.05
152 0.06
153 0.06
154 0.06
155 0.08
156 0.09
157 0.12
158 0.13
159 0.15
160 0.17
161 0.19
162 0.19
163 0.18
164 0.19
165 0.18
166 0.27
167 0.31
168 0.32
169 0.39
170 0.49
171 0.58
172 0.66
173 0.74
174 0.75
175 0.8
176 0.84
177 0.84
178 0.83
179 0.76
180 0.72
181 0.63
182 0.53
183 0.43
184 0.35
185 0.26
186 0.18
187 0.15
188 0.09
189 0.09
190 0.14
191 0.21
192 0.24
193 0.26
194 0.31
195 0.36
196 0.36
197 0.36
198 0.33
199 0.31
200 0.28
201 0.27
202 0.23
203 0.2
204 0.2
205 0.18
206 0.17
207 0.15
208 0.16
209 0.16
210 0.15
211 0.13
212 0.14
213 0.14
214 0.14
215 0.1
216 0.16
217 0.21
218 0.22
219 0.23
220 0.23
221 0.29
222 0.28
223 0.28
224 0.23
225 0.19
226 0.19
227 0.18
228 0.17
229 0.12
230 0.21
231 0.24
232 0.24
233 0.23
234 0.21
235 0.22
236 0.24
237 0.23
238 0.19
239 0.2
240 0.22
241 0.26
242 0.27
243 0.26
244 0.31
245 0.33
246 0.33
247 0.33
248 0.3
249 0.28
250 0.29
251 0.29
252 0.23
253 0.21
254 0.19
255 0.14
256 0.13
257 0.11
258 0.1
259 0.11
260 0.14
261 0.16
262 0.15
263 0.17
264 0.18
265 0.2
266 0.21
267 0.22
268 0.24
269 0.3
270 0.31
271 0.39
272 0.38
273 0.37
274 0.37
275 0.37
276 0.38
277 0.35
278 0.34
279 0.32
280 0.33
281 0.33
282 0.34
283 0.36
284 0.34
285 0.32
286 0.34
287 0.3
288 0.31
289 0.29
290 0.27
291 0.23
292 0.19
293 0.16
294 0.15
295 0.13
296 0.11
297 0.11
298 0.11
299 0.1
300 0.11
301 0.11
302 0.11
303 0.2
304 0.2
305 0.2
306 0.23
307 0.23
308 0.22
309 0.25
310 0.22
311 0.15
312 0.15
313 0.16
314 0.15
315 0.18
316 0.18
317 0.15
318 0.2
319 0.22
320 0.23
321 0.22
322 0.24
323 0.28
324 0.34
325 0.39
326 0.42
327 0.44
328 0.43