Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5J5EWL9

Protein Details
Accession A0A5J5EWL9   
Localization Confidence Medium
Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
144-180LKKVKKMQEVLRPKQKKRKQKRVRAAIENPKNKKQNTHydrophilic
NLS Segment(s)
PositionSequence
144-177LKKVKKMQEVLRPKQKKRKQKRVRAAIENPKNKK
Subcellular Location(s) cyto_nucl 8.833, mito 12.5, mito_nucl 12.499, nucl 11
Family & Domain DBs
Amino Acid Sequences IMTSITAGSILWLPDTPLVRSIPNIETGALDHPVLILRAPPGSESVRNVEILTITSFHNTPLIEKHSGQSRRAILRRAEYLPLKRSEEEPHPDSGALLEVFITGNPQVTQAKQSYVGLLKQHKVAREHLRALSGGTARIGPADLKKVKKMQEVLRPKQKKRKQKRVRAAIENPKNKKQNTTPAVVPGPSQTVPSPKH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.16
3 0.16
4 0.17
5 0.19
6 0.18
7 0.2
8 0.23
9 0.21
10 0.23
11 0.22
12 0.19
13 0.18
14 0.19
15 0.2
16 0.17
17 0.15
18 0.11
19 0.1
20 0.1
21 0.1
22 0.09
23 0.07
24 0.07
25 0.08
26 0.09
27 0.09
28 0.12
29 0.15
30 0.17
31 0.18
32 0.21
33 0.22
34 0.22
35 0.22
36 0.19
37 0.16
38 0.15
39 0.13
40 0.1
41 0.09
42 0.1
43 0.1
44 0.1
45 0.12
46 0.1
47 0.11
48 0.14
49 0.18
50 0.19
51 0.2
52 0.22
53 0.29
54 0.32
55 0.32
56 0.34
57 0.35
58 0.4
59 0.42
60 0.45
61 0.39
62 0.4
63 0.43
64 0.39
65 0.38
66 0.35
67 0.37
68 0.37
69 0.37
70 0.35
71 0.32
72 0.32
73 0.31
74 0.32
75 0.34
76 0.31
77 0.29
78 0.27
79 0.26
80 0.24
81 0.2
82 0.15
83 0.09
84 0.06
85 0.05
86 0.04
87 0.04
88 0.04
89 0.05
90 0.03
91 0.04
92 0.04
93 0.06
94 0.07
95 0.07
96 0.1
97 0.11
98 0.12
99 0.13
100 0.13
101 0.13
102 0.14
103 0.16
104 0.18
105 0.2
106 0.21
107 0.25
108 0.27
109 0.29
110 0.29
111 0.35
112 0.39
113 0.42
114 0.44
115 0.4
116 0.39
117 0.35
118 0.33
119 0.29
120 0.21
121 0.16
122 0.12
123 0.11
124 0.1
125 0.1
126 0.1
127 0.08
128 0.09
129 0.17
130 0.22
131 0.24
132 0.3
133 0.35
134 0.39
135 0.44
136 0.5
137 0.5
138 0.55
139 0.63
140 0.67
141 0.73
142 0.77
143 0.79
144 0.83
145 0.84
146 0.85
147 0.86
148 0.88
149 0.88
150 0.9
151 0.93
152 0.93
153 0.94
154 0.92
155 0.91
156 0.91
157 0.9
158 0.89
159 0.85
160 0.83
161 0.81
162 0.72
163 0.71
164 0.68
165 0.68
166 0.64
167 0.63
168 0.56
169 0.56
170 0.58
171 0.49
172 0.42
173 0.33
174 0.33
175 0.27
176 0.27
177 0.23