Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5J5EIY1

Protein Details
Accession A0A5J5EIY1    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-30RRSHTKSRKGCKTCKRRHIRCDETVPQCRNBasic
NLS Segment(s)
Subcellular Location(s) nucl 23.5, mito_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences RRSHTKSRKGCKTCKRRHIRCDETVPQCRNCTKHNVRCDYMDRDVVEGNPDLNMTPQVLQELERWRETGVYPFPNLGLELHPSPSLYSQTDLRLIHHISSIASQMQAVEPSNSAIWTKRVPMYVAVSI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.92
3 0.91
4 0.92
5 0.93
6 0.91
7 0.88
8 0.86
9 0.84
10 0.82
11 0.81
12 0.75
13 0.68
14 0.64
15 0.6
16 0.54
17 0.48
18 0.49
19 0.51
20 0.54
21 0.6
22 0.63
23 0.6
24 0.62
25 0.64
26 0.59
27 0.51
28 0.46
29 0.37
30 0.31
31 0.29
32 0.25
33 0.21
34 0.15
35 0.12
36 0.09
37 0.08
38 0.07
39 0.07
40 0.07
41 0.06
42 0.06
43 0.06
44 0.07
45 0.07
46 0.08
47 0.11
48 0.16
49 0.18
50 0.17
51 0.18
52 0.17
53 0.18
54 0.17
55 0.18
56 0.16
57 0.16
58 0.16
59 0.16
60 0.16
61 0.15
62 0.15
63 0.12
64 0.09
65 0.1
66 0.1
67 0.11
68 0.11
69 0.11
70 0.11
71 0.12
72 0.13
73 0.11
74 0.13
75 0.13
76 0.15
77 0.2
78 0.19
79 0.2
80 0.22
81 0.22
82 0.21
83 0.2
84 0.19
85 0.15
86 0.15
87 0.16
88 0.12
89 0.11
90 0.1
91 0.09
92 0.1
93 0.11
94 0.11
95 0.1
96 0.1
97 0.12
98 0.12
99 0.13
100 0.13
101 0.13
102 0.16
103 0.17
104 0.22
105 0.24
106 0.26
107 0.27
108 0.3