Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5J5EGT1

Protein Details
Accession A0A5J5EGT1    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
24-49SHSKAAAKQSQKKKKKIKTTFHCTFHHydrophilic
63-83QTEKKGKKKLEGGRGEKKKDRBasic
NLS Segment(s)
PositionSequence
29-40AAKQSQKKKKKI
66-81KKGKKKLEGGRGEKKK
Subcellular Location(s) mito 13, extr 6, nucl 2, cyto 2, cyto_nucl 2, vacu 2
Family & Domain DBs
Amino Acid Sequences MAGVGVFVFFVPFLHAHGTHQHHSHSKAAAKQSQKKKKKIKTTFHCTFHLAKTSIPTPTQTTQTEKKGKKKLEGGRGEKKKDRYLILTYI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.14
4 0.22
5 0.27
6 0.28
7 0.3
8 0.32
9 0.33
10 0.36
11 0.38
12 0.35
13 0.33
14 0.35
15 0.39
16 0.41
17 0.45
18 0.52
19 0.59
20 0.65
21 0.7
22 0.75
23 0.8
24 0.83
25 0.85
26 0.86
27 0.87
28 0.86
29 0.87
30 0.85
31 0.79
32 0.72
33 0.65
34 0.57
35 0.47
36 0.42
37 0.33
38 0.25
39 0.23
40 0.23
41 0.21
42 0.19
43 0.19
44 0.19
45 0.2
46 0.25
47 0.24
48 0.29
49 0.32
50 0.41
51 0.49
52 0.51
53 0.58
54 0.63
55 0.66
56 0.68
57 0.72
58 0.72
59 0.72
60 0.76
61 0.75
62 0.77
63 0.81
64 0.81
65 0.79
66 0.77
67 0.75
68 0.7
69 0.67
70 0.62