Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5J5EVD6

Protein Details
Accession A0A5J5EVD6    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
13-43TLQNPRAKPSCRRGKRNLPPRKPNLPRYKSIHydrophilic
NLS Segment(s)
PositionSequence
24-36RRGKRNLPPRKPN
Subcellular Location(s) nucl 17, cyto_nucl 10, mito 9
Family & Domain DBs
Amino Acid Sequences MDPGPLFRQAGSTLQNPRAKPSCRRGKRNLPPRKPNLPRYKSIVPPCKPILSPQEYVVPRCKSPLPRCKSHLPRCKSHLPRCKSPLPRCKSPLPRYESITPPCKSIPSPQKYLVPRCKSLLPRYESIIPPARNGACGGQAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.43
3 0.41
4 0.47
5 0.51
6 0.53
7 0.56
8 0.6
9 0.63
10 0.68
11 0.77
12 0.79
13 0.82
14 0.87
15 0.89
16 0.9
17 0.89
18 0.9
19 0.89
20 0.9
21 0.87
22 0.87
23 0.87
24 0.81
25 0.75
26 0.72
27 0.71
28 0.67
29 0.69
30 0.68
31 0.59
32 0.6
33 0.58
34 0.53
35 0.47
36 0.43
37 0.42
38 0.37
39 0.36
40 0.31
41 0.37
42 0.35
43 0.36
44 0.39
45 0.33
46 0.28
47 0.29
48 0.31
49 0.32
50 0.41
51 0.48
52 0.47
53 0.5
54 0.55
55 0.63
56 0.7
57 0.71
58 0.71
59 0.66
60 0.66
61 0.66
62 0.71
63 0.71
64 0.7
65 0.69
66 0.66
67 0.7
68 0.7
69 0.73
70 0.72
71 0.73
72 0.73
73 0.71
74 0.73
75 0.69
76 0.73
77 0.74
78 0.72
79 0.71
80 0.68
81 0.65
82 0.62
83 0.62
84 0.6
85 0.55
86 0.56
87 0.48
88 0.43
89 0.4
90 0.37
91 0.33
92 0.36
93 0.41
94 0.39
95 0.44
96 0.46
97 0.53
98 0.57
99 0.66
100 0.66
101 0.63
102 0.6
103 0.57
104 0.61
105 0.61
106 0.62
107 0.61
108 0.56
109 0.52
110 0.54
111 0.57
112 0.51
113 0.51
114 0.51
115 0.43
116 0.39
117 0.43
118 0.38
119 0.33
120 0.33
121 0.29