Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5J5EIS3

Protein Details
Accession A0A5J5EIS3    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
141-167VMMAPVKKQPKVRPQRKERKMVKIIVIHydrophilic
NLS Segment(s)
PositionSequence
147-160KKQPKVRPQRKERK
Subcellular Location(s) nucl 7, extr 6, mito_nucl 6, mito 5, cyto_nucl 5
Family & Domain DBs
Amino Acid Sequences MAVSASNTAGLAIWAAAKAGTSASFLENTVQEFEAQCCCILPSKISSEGSLGRIANFPSRHQANRANPSDFVRFTIENEATSALLLGILDLMLELVNSDQALEDDEPPTPPPQLKDFFNRRSFGNPDSPLDGVANEEFYHVMMAPVKKQPKVRPQRKERKMVKIIVI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.05
4 0.05
5 0.05
6 0.06
7 0.06
8 0.07
9 0.08
10 0.09
11 0.1
12 0.1
13 0.12
14 0.12
15 0.13
16 0.14
17 0.13
18 0.13
19 0.13
20 0.14
21 0.14
22 0.14
23 0.13
24 0.11
25 0.11
26 0.14
27 0.14
28 0.14
29 0.15
30 0.18
31 0.22
32 0.23
33 0.23
34 0.22
35 0.23
36 0.23
37 0.23
38 0.19
39 0.16
40 0.16
41 0.17
42 0.2
43 0.19
44 0.19
45 0.22
46 0.26
47 0.27
48 0.3
49 0.37
50 0.4
51 0.48
52 0.51
53 0.46
54 0.43
55 0.45
56 0.44
57 0.36
58 0.3
59 0.24
60 0.2
61 0.19
62 0.23
63 0.2
64 0.16
65 0.16
66 0.15
67 0.12
68 0.11
69 0.1
70 0.04
71 0.04
72 0.03
73 0.03
74 0.02
75 0.02
76 0.02
77 0.02
78 0.02
79 0.02
80 0.02
81 0.02
82 0.02
83 0.02
84 0.02
85 0.03
86 0.03
87 0.03
88 0.05
89 0.06
90 0.07
91 0.08
92 0.08
93 0.09
94 0.1
95 0.11
96 0.11
97 0.11
98 0.13
99 0.17
100 0.21
101 0.23
102 0.31
103 0.39
104 0.47
105 0.51
106 0.5
107 0.46
108 0.48
109 0.49
110 0.44
111 0.43
112 0.37
113 0.34
114 0.36
115 0.34
116 0.29
117 0.26
118 0.22
119 0.15
120 0.13
121 0.12
122 0.09
123 0.1
124 0.09
125 0.08
126 0.09
127 0.07
128 0.08
129 0.12
130 0.13
131 0.17
132 0.24
133 0.3
134 0.34
135 0.42
136 0.5
137 0.56
138 0.66
139 0.73
140 0.76
141 0.82
142 0.89
143 0.91
144 0.93
145 0.91
146 0.9
147 0.88