Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5J5EE54

Protein Details
Accession A0A5J5EE54    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
271-290DEGKRAKHAKHGKHGKHGKHBasic
NLS Segment(s)
PositionSequence
274-299KRAKHAKHGKHGKHGKHGEHGKHGKR
Subcellular Location(s) cyto 12, mito 8, extr 6, cyto_nucl 6, cyto_pero 6
Family & Domain DBs
Amino Acid Sequences MLLPILRSTPVLSPTPRSTPMLLPILRSTPVLSPTPRSTPMLSPILRLTPILSALADPKVDTHALACPKVDTASNSLADPIVDTASSALADPKVDTASSSLADPKVDTHALSCPKVDTASSALADPKVDTASSSLADPKVDTHALACPKVDTASNSLADPKVDTHALARPKVDTASSSLADPKVDNKACSDPKVGSKAGADPKVDTKAGSAADAAAIPHVKSCNQHSQPIAEVVEPVVVKNTPTIDVVAPCSRVTAPAVTHTCHHDCIPCDEGKRAKHAKHGKHGKHGKHGEHGKHGKRHISVALPIGCDCEDSCHHEAGFTVITPTPAVECVQMAPEVRKHQPVEVVKPHVEPVDIIQPV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.42
3 0.43
4 0.42
5 0.42
6 0.4
7 0.44
8 0.45
9 0.41
10 0.38
11 0.38
12 0.37
13 0.34
14 0.32
15 0.27
16 0.23
17 0.26
18 0.28
19 0.28
20 0.32
21 0.36
22 0.42
23 0.43
24 0.42
25 0.42
26 0.4
27 0.44
28 0.46
29 0.41
30 0.37
31 0.36
32 0.36
33 0.33
34 0.29
35 0.23
36 0.17
37 0.17
38 0.15
39 0.13
40 0.11
41 0.13
42 0.14
43 0.13
44 0.12
45 0.11
46 0.13
47 0.13
48 0.12
49 0.11
50 0.16
51 0.19
52 0.2
53 0.2
54 0.18
55 0.19
56 0.2
57 0.2
58 0.16
59 0.17
60 0.21
61 0.21
62 0.2
63 0.2
64 0.19
65 0.17
66 0.15
67 0.11
68 0.07
69 0.06
70 0.06
71 0.06
72 0.06
73 0.06
74 0.06
75 0.07
76 0.07
77 0.07
78 0.07
79 0.08
80 0.09
81 0.08
82 0.09
83 0.09
84 0.1
85 0.1
86 0.1
87 0.12
88 0.12
89 0.12
90 0.12
91 0.12
92 0.14
93 0.14
94 0.13
95 0.12
96 0.18
97 0.21
98 0.22
99 0.21
100 0.18
101 0.18
102 0.19
103 0.17
104 0.13
105 0.12
106 0.13
107 0.13
108 0.13
109 0.14
110 0.14
111 0.14
112 0.13
113 0.11
114 0.09
115 0.09
116 0.09
117 0.09
118 0.1
119 0.1
120 0.1
121 0.12
122 0.12
123 0.12
124 0.12
125 0.12
126 0.14
127 0.14
128 0.13
129 0.12
130 0.17
131 0.21
132 0.22
133 0.21
134 0.18
135 0.19
136 0.2
137 0.2
138 0.16
139 0.17
140 0.21
141 0.21
142 0.2
143 0.21
144 0.2
145 0.18
146 0.17
147 0.12
148 0.1
149 0.09
150 0.09
151 0.09
152 0.14
153 0.17
154 0.17
155 0.17
156 0.16
157 0.16
158 0.17
159 0.15
160 0.11
161 0.11
162 0.13
163 0.13
164 0.14
165 0.16
166 0.16
167 0.16
168 0.15
169 0.14
170 0.18
171 0.19
172 0.18
173 0.18
174 0.24
175 0.26
176 0.28
177 0.28
178 0.22
179 0.25
180 0.29
181 0.27
182 0.21
183 0.2
184 0.23
185 0.27
186 0.28
187 0.25
188 0.22
189 0.25
190 0.26
191 0.26
192 0.2
193 0.15
194 0.14
195 0.14
196 0.13
197 0.1
198 0.08
199 0.08
200 0.08
201 0.07
202 0.05
203 0.06
204 0.05
205 0.06
206 0.07
207 0.08
208 0.1
209 0.15
210 0.25
211 0.27
212 0.31
213 0.31
214 0.32
215 0.33
216 0.34
217 0.29
218 0.19
219 0.16
220 0.12
221 0.14
222 0.12
223 0.1
224 0.09
225 0.08
226 0.08
227 0.09
228 0.1
229 0.09
230 0.09
231 0.11
232 0.11
233 0.12
234 0.16
235 0.16
236 0.17
237 0.15
238 0.16
239 0.15
240 0.15
241 0.15
242 0.14
243 0.13
244 0.19
245 0.22
246 0.21
247 0.23
248 0.27
249 0.28
250 0.27
251 0.27
252 0.23
253 0.23
254 0.27
255 0.29
256 0.27
257 0.27
258 0.3
259 0.35
260 0.34
261 0.41
262 0.44
263 0.42
264 0.5
265 0.57
266 0.61
267 0.66
268 0.74
269 0.71
270 0.75
271 0.82
272 0.78
273 0.79
274 0.78
275 0.71
276 0.7
277 0.73
278 0.67
279 0.68
280 0.72
281 0.69
282 0.69
283 0.7
284 0.67
285 0.6
286 0.59
287 0.52
288 0.47
289 0.42
290 0.42
291 0.39
292 0.34
293 0.32
294 0.3
295 0.25
296 0.22
297 0.19
298 0.16
299 0.16
300 0.22
301 0.24
302 0.25
303 0.25
304 0.24
305 0.24
306 0.23
307 0.21
308 0.14
309 0.14
310 0.13
311 0.13
312 0.13
313 0.13
314 0.11
315 0.11
316 0.12
317 0.1
318 0.1
319 0.11
320 0.12
321 0.14
322 0.15
323 0.18
324 0.23
325 0.29
326 0.32
327 0.38
328 0.39
329 0.4
330 0.47
331 0.5
332 0.54
333 0.56
334 0.59
335 0.54
336 0.54
337 0.53
338 0.45
339 0.39
340 0.3
341 0.26