Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5J5F539

Protein Details
Accession A0A5J5F539    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
113-141GCSNVRILRKRNELRSRARRHYDRRHWHNBasic
NLS Segment(s)
PositionSequence
123-123R
125-132ELRSRARR
Subcellular Location(s) nucl 12, mito 6, cyto 6, cyto_mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR029071  Ubiquitin-like_domsf  
Amino Acid Sequences MSTVNSNLPEASIHTHHHPVTLILTRSPTCSSLPTLKPKHLTLSPSQTFNDLRALVRSQLNLHKTPERCLFLTVNGELIAGNMTMWTLQRDFGVQVVYSEEFPGIEEELEATGCSNVRILRKRNELRSRARRHYDRRHWHN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.29
3 0.28
4 0.29
5 0.28
6 0.24
7 0.25
8 0.28
9 0.25
10 0.21
11 0.25
12 0.24
13 0.26
14 0.26
15 0.24
16 0.19
17 0.2
18 0.23
19 0.27
20 0.32
21 0.4
22 0.42
23 0.45
24 0.48
25 0.47
26 0.49
27 0.44
28 0.42
29 0.38
30 0.44
31 0.41
32 0.39
33 0.38
34 0.36
35 0.33
36 0.3
37 0.28
38 0.19
39 0.17
40 0.16
41 0.17
42 0.17
43 0.17
44 0.17
45 0.16
46 0.21
47 0.24
48 0.24
49 0.26
50 0.29
51 0.29
52 0.33
53 0.35
54 0.33
55 0.29
56 0.3
57 0.27
58 0.23
59 0.24
60 0.2
61 0.15
62 0.12
63 0.11
64 0.09
65 0.08
66 0.07
67 0.04
68 0.04
69 0.03
70 0.03
71 0.03
72 0.04
73 0.05
74 0.05
75 0.06
76 0.06
77 0.07
78 0.08
79 0.08
80 0.09
81 0.08
82 0.08
83 0.1
84 0.1
85 0.1
86 0.1
87 0.09
88 0.07
89 0.08
90 0.09
91 0.07
92 0.06
93 0.06
94 0.06
95 0.06
96 0.07
97 0.06
98 0.06
99 0.06
100 0.06
101 0.06
102 0.08
103 0.11
104 0.18
105 0.26
106 0.32
107 0.41
108 0.52
109 0.6
110 0.69
111 0.76
112 0.77
113 0.8
114 0.85
115 0.86
116 0.85
117 0.87
118 0.87
119 0.87
120 0.9
121 0.9