Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5J5F052

Protein Details
Accession A0A5J5F052    Localization Confidence High Confidence Score 18.5
NoLS Segment(s)
PositionSequenceProtein Nature
397-430EEKEEELKERPRRKRGESERDRKRRRVVDESDEEAcidic
NLS Segment(s)
PositionSequence
311-363RKEAERIAREKDRANRKLEAQRRRARERDPLETAAKRSYAKVTGTRSKRESPP
404-422KERPRRKRGESERDRKRRR
Subcellular Location(s) nucl 22, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR007149  Leo1  
Gene Ontology GO:0016593  C:Cdc73/Paf1 complex  
GO:0016570  P:histone modification  
GO:0006368  P:transcription elongation by RNA polymerase II  
Pfam View protein in Pfam  
PF04004  Leo1  
Amino Acid Sequences MSDTDLSSIEGDSSPAPQTQPSQSEQPTSNRYDTMFGSDHESGDESDAASTRKRVPKSPAAAASGDEENEELDDLFGDGDNDEELVPPTTTEKNDLSDADLAESPPPRHHPPTPEPERFVEITLPRHPAPGPGSDKHLYLMKIPSFLSMEPQLFDPEKFTMPNMEPSDTVSAYTKATTAIRYRRDPKNPDNLQSNARIIRWSDGTLSLQIASSSSLYDLPRKDLTTDPSKPDKYLPAQDSHTFVLDPHESAGTLRVVGHATQSLNVVSASVNLASDHAIQRLHSELASAIPMNMRKAPLEISELKDPEAERKEAERIAREKDRANRKLEAQRRRARERDPLETAAKRSYAKVTGTRSKRESPPITRGGRGKEDEYDLEDGFIEGSEEEEEAEVSDEEEKEEELKERPRRKRGESERDRKRRRVVDESDEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.15
4 0.16
5 0.2
6 0.26
7 0.3
8 0.32
9 0.38
10 0.39
11 0.43
12 0.46
13 0.49
14 0.48
15 0.49
16 0.48
17 0.42
18 0.41
19 0.38
20 0.35
21 0.34
22 0.29
23 0.24
24 0.28
25 0.27
26 0.26
27 0.24
28 0.24
29 0.18
30 0.18
31 0.18
32 0.11
33 0.11
34 0.13
35 0.13
36 0.14
37 0.17
38 0.24
39 0.31
40 0.34
41 0.4
42 0.47
43 0.55
44 0.6
45 0.65
46 0.62
47 0.58
48 0.55
49 0.49
50 0.44
51 0.36
52 0.29
53 0.2
54 0.15
55 0.11
56 0.11
57 0.1
58 0.07
59 0.05
60 0.05
61 0.05
62 0.05
63 0.05
64 0.05
65 0.05
66 0.05
67 0.05
68 0.05
69 0.05
70 0.06
71 0.07
72 0.08
73 0.08
74 0.08
75 0.11
76 0.14
77 0.15
78 0.19
79 0.19
80 0.2
81 0.22
82 0.22
83 0.22
84 0.21
85 0.21
86 0.19
87 0.18
88 0.16
89 0.16
90 0.19
91 0.17
92 0.18
93 0.24
94 0.27
95 0.32
96 0.36
97 0.42
98 0.48
99 0.57
100 0.63
101 0.63
102 0.61
103 0.58
104 0.57
105 0.49
106 0.42
107 0.37
108 0.31
109 0.3
110 0.3
111 0.32
112 0.28
113 0.29
114 0.28
115 0.27
116 0.26
117 0.29
118 0.31
119 0.28
120 0.34
121 0.33
122 0.33
123 0.31
124 0.32
125 0.25
126 0.22
127 0.26
128 0.21
129 0.22
130 0.22
131 0.22
132 0.2
133 0.19
134 0.19
135 0.17
136 0.16
137 0.15
138 0.15
139 0.16
140 0.16
141 0.16
142 0.15
143 0.14
144 0.14
145 0.14
146 0.14
147 0.15
148 0.16
149 0.23
150 0.23
151 0.22
152 0.21
153 0.23
154 0.25
155 0.21
156 0.2
157 0.14
158 0.13
159 0.12
160 0.13
161 0.11
162 0.09
163 0.1
164 0.12
165 0.17
166 0.23
167 0.28
168 0.35
169 0.42
170 0.48
171 0.56
172 0.61
173 0.62
174 0.66
175 0.64
176 0.62
177 0.6
178 0.55
179 0.49
180 0.44
181 0.4
182 0.3
183 0.27
184 0.23
185 0.18
186 0.18
187 0.16
188 0.14
189 0.12
190 0.12
191 0.12
192 0.12
193 0.12
194 0.1
195 0.09
196 0.08
197 0.07
198 0.06
199 0.05
200 0.05
201 0.05
202 0.07
203 0.08
204 0.12
205 0.12
206 0.15
207 0.16
208 0.16
209 0.18
210 0.18
211 0.22
212 0.27
213 0.29
214 0.31
215 0.37
216 0.37
217 0.36
218 0.35
219 0.36
220 0.32
221 0.36
222 0.33
223 0.3
224 0.32
225 0.33
226 0.34
227 0.29
228 0.26
229 0.18
230 0.16
231 0.16
232 0.13
233 0.12
234 0.1
235 0.09
236 0.09
237 0.09
238 0.11
239 0.07
240 0.07
241 0.07
242 0.07
243 0.08
244 0.08
245 0.09
246 0.09
247 0.09
248 0.09
249 0.1
250 0.09
251 0.09
252 0.08
253 0.08
254 0.06
255 0.06
256 0.06
257 0.05
258 0.06
259 0.05
260 0.06
261 0.06
262 0.08
263 0.09
264 0.09
265 0.1
266 0.1
267 0.11
268 0.13
269 0.12
270 0.1
271 0.1
272 0.09
273 0.09
274 0.1
275 0.09
276 0.07
277 0.09
278 0.1
279 0.12
280 0.13
281 0.13
282 0.13
283 0.14
284 0.15
285 0.14
286 0.19
287 0.2
288 0.23
289 0.27
290 0.28
291 0.27
292 0.27
293 0.26
294 0.28
295 0.29
296 0.26
297 0.22
298 0.24
299 0.27
300 0.29
301 0.32
302 0.31
303 0.31
304 0.37
305 0.42
306 0.42
307 0.45
308 0.51
309 0.58
310 0.58
311 0.59
312 0.56
313 0.58
314 0.65
315 0.67
316 0.69
317 0.69
318 0.71
319 0.74
320 0.79
321 0.77
322 0.72
323 0.74
324 0.7
325 0.67
326 0.65
327 0.61
328 0.59
329 0.56
330 0.54
331 0.46
332 0.43
333 0.36
334 0.32
335 0.32
336 0.29
337 0.3
338 0.34
339 0.39
340 0.46
341 0.51
342 0.57
343 0.58
344 0.61
345 0.63
346 0.67
347 0.68
348 0.65
349 0.68
350 0.69
351 0.67
352 0.65
353 0.64
354 0.61
355 0.59
356 0.55
357 0.49
358 0.44
359 0.44
360 0.4
361 0.38
362 0.35
363 0.28
364 0.24
365 0.22
366 0.18
367 0.14
368 0.12
369 0.09
370 0.05
371 0.06
372 0.06
373 0.06
374 0.06
375 0.06
376 0.06
377 0.06
378 0.08
379 0.07
380 0.07
381 0.1
382 0.1
383 0.11
384 0.11
385 0.11
386 0.11
387 0.13
388 0.15
389 0.18
390 0.28
391 0.37
392 0.46
393 0.56
394 0.65
395 0.72
396 0.78
397 0.83
398 0.85
399 0.87
400 0.88
401 0.89
402 0.9
403 0.93
404 0.94
405 0.91
406 0.9
407 0.88
408 0.85
409 0.84
410 0.81