Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5J5EIX3

Protein Details
Accession A0A5J5EIX3   
Localization Confidence Medium
Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
40-78ASDTRKAKRKAKVKAWRKAWRKDNRKKDRQREKKVTGETBasic
NLS Segment(s)
PositionSequence
44-73RKAKRKAKVKAWRKAWRKDNRKKDRQREKK
Subcellular Location(s) mito 14, nucl 11
Family & Domain DBs
Amino Acid Sequences MAESRSIQGRARANGAASAAPAAKAETPQATVLSPPTIPASDTRKAKRKAKVKAWRKAWRKDNRKKDRQREKKVTGETAVTPAPASVRQKSGSIFVDVSHCTGMDVSWNLAPDGTVAGITCSFRGSKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.3
3 0.23
4 0.17
5 0.16
6 0.12
7 0.11
8 0.1
9 0.1
10 0.09
11 0.09
12 0.11
13 0.11
14 0.12
15 0.13
16 0.14
17 0.13
18 0.13
19 0.13
20 0.13
21 0.11
22 0.1
23 0.11
24 0.11
25 0.11
26 0.15
27 0.19
28 0.24
29 0.31
30 0.37
31 0.44
32 0.51
33 0.58
34 0.63
35 0.66
36 0.69
37 0.73
38 0.77
39 0.78
40 0.8
41 0.83
42 0.85
43 0.84
44 0.83
45 0.82
46 0.82
47 0.83
48 0.84
49 0.85
50 0.86
51 0.89
52 0.9
53 0.91
54 0.91
55 0.91
56 0.92
57 0.91
58 0.87
59 0.84
60 0.78
61 0.7
62 0.6
63 0.51
64 0.4
65 0.33
66 0.26
67 0.18
68 0.14
69 0.11
70 0.1
71 0.12
72 0.15
73 0.15
74 0.18
75 0.19
76 0.2
77 0.21
78 0.25
79 0.23
80 0.22
81 0.2
82 0.18
83 0.2
84 0.19
85 0.19
86 0.15
87 0.13
88 0.1
89 0.1
90 0.09
91 0.1
92 0.11
93 0.11
94 0.12
95 0.13
96 0.13
97 0.13
98 0.13
99 0.09
100 0.09
101 0.08
102 0.06
103 0.06
104 0.07
105 0.09
106 0.1
107 0.09
108 0.1