Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5J5F4V1

Protein Details
Accession A0A5J5F4V1    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
2-30VCSLPPLKEGKKQKKKWSKVKDKAQHAVVHydrophilic
NLS Segment(s)
PositionSequence
9-23KEGKKQKKKWSKVKD
Subcellular Location(s) nucl 12.5cyto_nucl 12.5, cyto 11.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MVCSLPPLKEGKKQKKKWSKVKDKAQHAVVMDKTIQERLNKDVLTYRFDITTAVLEKGVIKKIVGHHKLNILQYV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.83
3 0.9
4 0.92
5 0.92
6 0.92
7 0.91
8 0.93
9 0.92
10 0.89
11 0.85
12 0.77
13 0.69
14 0.58
15 0.52
16 0.41
17 0.34
18 0.25
19 0.19
20 0.17
21 0.16
22 0.17
23 0.15
24 0.16
25 0.17
26 0.21
27 0.19
28 0.19
29 0.23
30 0.22
31 0.24
32 0.25
33 0.23
34 0.19
35 0.19
36 0.19
37 0.13
38 0.15
39 0.13
40 0.12
41 0.11
42 0.11
43 0.14
44 0.16
45 0.19
46 0.16
47 0.14
48 0.17
49 0.25
50 0.36
51 0.4
52 0.4
53 0.41
54 0.48
55 0.53