Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5J5ELB2

Protein Details
Accession A0A5J5ELB2    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
57-81PASDLKKGKRKANRKRKAKMPIENDBasic
NLS Segment(s)
PositionSequence
62-77KKGKRKANRKRKAKMP
Subcellular Location(s) mito 17.5, cyto_mito 12, cyto 5.5, extr 2
Family & Domain DBs
Amino Acid Sequences MAAFIRRVFQGRVAGAAAPDTAVATPAPDAPDDAAVVTAAADGEFSEATVPPPPTIPASDLKKGKRKANRKRKAKMPIENDNPRKVPKLESTTPESASASASAVQGNTTSINVEVPNYQGVDIAWNINANGTASAVTFSFGGSTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.21
3 0.2
4 0.15
5 0.09
6 0.09
7 0.07
8 0.06
9 0.06
10 0.06
11 0.06
12 0.06
13 0.08
14 0.09
15 0.08
16 0.09
17 0.09
18 0.1
19 0.1
20 0.09
21 0.08
22 0.06
23 0.06
24 0.05
25 0.05
26 0.04
27 0.03
28 0.03
29 0.03
30 0.04
31 0.04
32 0.04
33 0.04
34 0.05
35 0.06
36 0.09
37 0.1
38 0.1
39 0.1
40 0.11
41 0.12
42 0.13
43 0.14
44 0.17
45 0.21
46 0.27
47 0.32
48 0.37
49 0.44
50 0.48
51 0.53
52 0.56
53 0.62
54 0.67
55 0.73
56 0.78
57 0.8
58 0.83
59 0.84
60 0.85
61 0.83
62 0.81
63 0.77
64 0.76
65 0.75
66 0.77
67 0.72
68 0.66
69 0.59
70 0.52
71 0.47
72 0.39
73 0.34
74 0.32
75 0.36
76 0.35
77 0.37
78 0.42
79 0.42
80 0.42
81 0.38
82 0.32
83 0.24
84 0.21
85 0.17
86 0.11
87 0.1
88 0.09
89 0.08
90 0.08
91 0.08
92 0.07
93 0.07
94 0.07
95 0.06
96 0.07
97 0.06
98 0.08
99 0.08
100 0.09
101 0.09
102 0.09
103 0.11
104 0.11
105 0.1
106 0.1
107 0.1
108 0.11
109 0.11
110 0.11
111 0.1
112 0.1
113 0.1
114 0.1
115 0.11
116 0.09
117 0.09
118 0.08
119 0.08
120 0.07
121 0.08
122 0.08
123 0.08
124 0.07
125 0.07