Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5J5FBB6

Protein Details
Accession A0A5J5FBB6   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
133-158RISAAQLQKNKKNPNKKRKADDESESHydrophilic
NLS Segment(s)
PositionSequence
142-151NKKNPNKKRK
Subcellular Location(s) cyto 5, cyto_nucl 15.5, nucl 22
Family & Domain DBs
InterPro View protein in InterPro  
IPR015418  Eaf6  
Gene Ontology GO:0035267  C:NuA4 histone acetyltransferase complex  
GO:0005634  C:nucleus  
GO:0016740  F:transferase activity  
GO:0006325  P:chromatin organization  
GO:0006281  P:DNA repair  
GO:0016573  P:histone acetylation  
Pfam View protein in Pfam  
PF09340  NuA4  
Amino Acid Sequences MPEAIPVPPASAKPTPAPQGHTREQGMAMYERIRKQLRDLIHQKRHHDKQLALYEDNIFKAESTYLEETQNGNIIKGFDNYIKGGVTRRKTAFNDSDRIFSLSSLTYASKLQQEHESTPVTAASTPTVPDLPRISAAQLQKNKKNPNKKRKADDESESVSDVETPGPKRVRISFSGQGHAVGTQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.38
3 0.39
4 0.44
5 0.45
6 0.51
7 0.53
8 0.55
9 0.5
10 0.45
11 0.43
12 0.38
13 0.33
14 0.26
15 0.23
16 0.22
17 0.25
18 0.25
19 0.31
20 0.34
21 0.31
22 0.35
23 0.39
24 0.38
25 0.44
26 0.51
27 0.55
28 0.62
29 0.66
30 0.69
31 0.73
32 0.76
33 0.73
34 0.69
35 0.61
36 0.6
37 0.63
38 0.61
39 0.51
40 0.45
41 0.4
42 0.35
43 0.33
44 0.24
45 0.16
46 0.11
47 0.11
48 0.1
49 0.08
50 0.11
51 0.14
52 0.15
53 0.15
54 0.16
55 0.16
56 0.16
57 0.2
58 0.15
59 0.12
60 0.12
61 0.12
62 0.12
63 0.12
64 0.13
65 0.1
66 0.11
67 0.11
68 0.11
69 0.1
70 0.1
71 0.14
72 0.18
73 0.2
74 0.24
75 0.25
76 0.3
77 0.31
78 0.37
79 0.39
80 0.37
81 0.4
82 0.36
83 0.36
84 0.32
85 0.32
86 0.26
87 0.18
88 0.16
89 0.1
90 0.1
91 0.09
92 0.08
93 0.08
94 0.08
95 0.1
96 0.12
97 0.12
98 0.14
99 0.18
100 0.21
101 0.21
102 0.24
103 0.24
104 0.21
105 0.21
106 0.19
107 0.14
108 0.12
109 0.11
110 0.09
111 0.08
112 0.08
113 0.09
114 0.1
115 0.1
116 0.12
117 0.14
118 0.14
119 0.15
120 0.15
121 0.16
122 0.19
123 0.24
124 0.29
125 0.36
126 0.42
127 0.48
128 0.56
129 0.64
130 0.68
131 0.75
132 0.78
133 0.82
134 0.85
135 0.87
136 0.89
137 0.89
138 0.89
139 0.85
140 0.8
141 0.75
142 0.7
143 0.62
144 0.53
145 0.43
146 0.34
147 0.27
148 0.21
149 0.17
150 0.16
151 0.16
152 0.23
153 0.26
154 0.27
155 0.32
156 0.37
157 0.41
158 0.4
159 0.46
160 0.48
161 0.49
162 0.52
163 0.48
164 0.43