Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5J5ET04

Protein Details
Accession A0A5J5ET04    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
168-191LVPLPPRSRPSRAPRGRRSSRAGLHydrophilic
NLS Segment(s)
PositionSequence
173-189PRSRPSRAPRGRRSSRA
Subcellular Location(s) extr 17, plas 7, E.R. 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR018466  Kre9/Knh1-like_N  
Pfam View protein in Pfam  
PF10342  Kre9_KNH  
Amino Acid Sequences MRFTSIFAVAVAGLSALASAVAMPDSGSANQNTVFAPVASSVVKAGVKFNIQWAPNAGKYVDLVLRKGTDETQLQEVQVICTRLPNVGLFIWEPSTELAGGSDYSIEVTSHDRPSTTTRPNSRSTPTAPASSRRPPSSPPPPTPSPPPRLAAALLPTLPLLMTRPLPLVPLPPRSRPSRAPRGRRSSRAGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.03
4 0.03
5 0.02
6 0.02
7 0.03
8 0.03
9 0.03
10 0.03
11 0.05
12 0.07
13 0.08
14 0.1
15 0.11
16 0.12
17 0.13
18 0.14
19 0.13
20 0.12
21 0.12
22 0.1
23 0.1
24 0.09
25 0.1
26 0.09
27 0.09
28 0.08
29 0.1
30 0.11
31 0.11
32 0.12
33 0.12
34 0.14
35 0.14
36 0.18
37 0.21
38 0.21
39 0.21
40 0.23
41 0.25
42 0.25
43 0.26
44 0.21
45 0.16
46 0.16
47 0.17
48 0.17
49 0.14
50 0.14
51 0.14
52 0.15
53 0.15
54 0.16
55 0.14
56 0.14
57 0.14
58 0.15
59 0.18
60 0.18
61 0.17
62 0.18
63 0.17
64 0.15
65 0.16
66 0.15
67 0.11
68 0.11
69 0.12
70 0.1
71 0.11
72 0.09
73 0.09
74 0.08
75 0.09
76 0.08
77 0.08
78 0.08
79 0.07
80 0.08
81 0.06
82 0.06
83 0.06
84 0.05
85 0.05
86 0.04
87 0.05
88 0.04
89 0.04
90 0.03
91 0.04
92 0.04
93 0.04
94 0.05
95 0.08
96 0.11
97 0.12
98 0.12
99 0.12
100 0.14
101 0.2
102 0.27
103 0.3
104 0.35
105 0.4
106 0.45
107 0.49
108 0.51
109 0.48
110 0.46
111 0.42
112 0.42
113 0.38
114 0.39
115 0.37
116 0.38
117 0.4
118 0.44
119 0.47
120 0.42
121 0.42
122 0.4
123 0.48
124 0.54
125 0.56
126 0.54
127 0.56
128 0.57
129 0.59
130 0.65
131 0.64
132 0.6
133 0.56
134 0.52
135 0.46
136 0.43
137 0.4
138 0.33
139 0.28
140 0.23
141 0.19
142 0.17
143 0.16
144 0.13
145 0.12
146 0.1
147 0.09
148 0.09
149 0.1
150 0.11
151 0.13
152 0.13
153 0.15
154 0.15
155 0.21
156 0.24
157 0.33
158 0.36
159 0.42
160 0.47
161 0.52
162 0.58
163 0.6
164 0.64
165 0.66
166 0.72
167 0.76
168 0.81
169 0.86
170 0.89
171 0.87