Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5J5EHP3

Protein Details
Accession A0A5J5EHP3   
Localization Confidence Medium
Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
341-372AIPRAYRPINEKRKRQEKQRREGTRRSARLQEHydrophilic
NLS Segment(s)
PositionSequence
350-367NEKRKRQEKQRREGTRRS
Subcellular Location(s) cyto_nucl 8, mito 8, nucl 10
Family & Domain DBs
Amino Acid Sequences MARRQYEEKQQAHEAAMRAQQQTPADSYTQQADPAVEDLGARFAGFGYPTQRDIDEQRLEQERIRRLRAQQDAGNDLHRQMGGSGWGGGGAWGGGRGAAWSGDRAFGGSSGGLGGGWGPRMDQPRPMRFPDSEASVNMTEWMVKHRLRMNDVPCFYGQIGLENLRKWQMDGEHFAKIAGLSENGDNQPRLDQIWPIRAGMVSLCGVEGLRYCLPPPAPVSVFLGGSESQDDGCFRIRVSQYPRMEAANEKRQSQTFREGDRVMIKTATLPLTYGNAAAGDGEARLSRTLPQRYIGPYTLGNLVGENAFRIVDLPDYLRKHRAKELVREYVAAKADEDLTAAIPRAYRPINEKRKRQEKQRREGTRRSARLQEARAFMVEIGLAEEAEERKTSDCV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.38
3 0.4
4 0.38
5 0.35
6 0.34
7 0.36
8 0.33
9 0.34
10 0.31
11 0.28
12 0.25
13 0.24
14 0.25
15 0.25
16 0.24
17 0.22
18 0.2
19 0.18
20 0.17
21 0.17
22 0.15
23 0.11
24 0.1
25 0.1
26 0.1
27 0.1
28 0.08
29 0.07
30 0.07
31 0.08
32 0.09
33 0.1
34 0.14
35 0.17
36 0.19
37 0.2
38 0.21
39 0.22
40 0.26
41 0.32
42 0.32
43 0.31
44 0.35
45 0.39
46 0.4
47 0.41
48 0.45
49 0.45
50 0.46
51 0.51
52 0.51
53 0.51
54 0.59
55 0.63
56 0.61
57 0.55
58 0.54
59 0.53
60 0.48
61 0.46
62 0.37
63 0.29
64 0.25
65 0.22
66 0.17
67 0.13
68 0.12
69 0.11
70 0.1
71 0.1
72 0.08
73 0.08
74 0.07
75 0.07
76 0.06
77 0.04
78 0.03
79 0.03
80 0.03
81 0.03
82 0.03
83 0.03
84 0.04
85 0.05
86 0.05
87 0.07
88 0.08
89 0.09
90 0.09
91 0.09
92 0.09
93 0.08
94 0.08
95 0.07
96 0.06
97 0.05
98 0.05
99 0.04
100 0.04
101 0.04
102 0.04
103 0.05
104 0.05
105 0.06
106 0.09
107 0.14
108 0.15
109 0.23
110 0.3
111 0.39
112 0.43
113 0.47
114 0.47
115 0.43
116 0.47
117 0.41
118 0.39
119 0.31
120 0.27
121 0.27
122 0.23
123 0.22
124 0.18
125 0.16
126 0.11
127 0.1
128 0.13
129 0.14
130 0.14
131 0.19
132 0.23
133 0.27
134 0.32
135 0.38
136 0.39
137 0.43
138 0.43
139 0.41
140 0.36
141 0.34
142 0.29
143 0.25
144 0.2
145 0.13
146 0.14
147 0.15
148 0.17
149 0.16
150 0.16
151 0.16
152 0.16
153 0.15
154 0.15
155 0.15
156 0.16
157 0.22
158 0.23
159 0.22
160 0.22
161 0.22
162 0.2
163 0.16
164 0.14
165 0.09
166 0.07
167 0.06
168 0.07
169 0.09
170 0.09
171 0.11
172 0.1
173 0.1
174 0.1
175 0.1
176 0.11
177 0.09
178 0.12
179 0.13
180 0.18
181 0.18
182 0.17
183 0.17
184 0.16
185 0.15
186 0.12
187 0.11
188 0.06
189 0.05
190 0.05
191 0.05
192 0.05
193 0.05
194 0.05
195 0.07
196 0.08
197 0.08
198 0.08
199 0.11
200 0.11
201 0.12
202 0.14
203 0.14
204 0.14
205 0.15
206 0.17
207 0.16
208 0.16
209 0.14
210 0.14
211 0.11
212 0.1
213 0.1
214 0.07
215 0.07
216 0.07
217 0.07
218 0.07
219 0.09
220 0.09
221 0.08
222 0.15
223 0.15
224 0.21
225 0.28
226 0.36
227 0.35
228 0.38
229 0.39
230 0.33
231 0.34
232 0.34
233 0.34
234 0.35
235 0.35
236 0.34
237 0.36
238 0.38
239 0.4
240 0.38
241 0.4
242 0.36
243 0.36
244 0.4
245 0.38
246 0.38
247 0.39
248 0.36
249 0.28
250 0.23
251 0.2
252 0.17
253 0.19
254 0.17
255 0.12
256 0.11
257 0.1
258 0.12
259 0.12
260 0.11
261 0.08
262 0.07
263 0.07
264 0.07
265 0.06
266 0.04
267 0.04
268 0.04
269 0.05
270 0.05
271 0.06
272 0.07
273 0.12
274 0.19
275 0.24
276 0.25
277 0.27
278 0.31
279 0.34
280 0.38
281 0.35
282 0.29
283 0.25
284 0.25
285 0.25
286 0.22
287 0.18
288 0.13
289 0.13
290 0.11
291 0.1
292 0.09
293 0.07
294 0.06
295 0.06
296 0.07
297 0.07
298 0.07
299 0.08
300 0.11
301 0.17
302 0.21
303 0.25
304 0.33
305 0.36
306 0.39
307 0.45
308 0.52
309 0.52
310 0.58
311 0.64
312 0.65
313 0.62
314 0.6
315 0.53
316 0.5
317 0.45
318 0.35
319 0.26
320 0.18
321 0.18
322 0.16
323 0.16
324 0.11
325 0.1
326 0.1
327 0.1
328 0.1
329 0.1
330 0.1
331 0.15
332 0.16
333 0.18
334 0.25
335 0.36
336 0.47
337 0.55
338 0.65
339 0.7
340 0.8
341 0.85
342 0.89
343 0.89
344 0.89
345 0.9
346 0.92
347 0.92
348 0.9
349 0.91
350 0.91
351 0.9
352 0.87
353 0.82
354 0.8
355 0.77
356 0.77
357 0.74
358 0.7
359 0.63
360 0.57
361 0.52
362 0.45
363 0.35
364 0.28
365 0.21
366 0.13
367 0.11
368 0.09
369 0.08
370 0.07
371 0.1
372 0.1
373 0.11
374 0.12
375 0.12