Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5J5ESI2

Protein Details
Accession A0A5J5ESI2   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
1-49MVTAKKHIPIVKKRTKKFNRHQSDLYKCVASAWRKPKGIDNRVRRRFKGHydrophilic
NLS Segment(s)
PositionSequence
12-17KKRTKK
36-38PKG
41-46NRVRRR
Subcellular Location(s) cyto 7, mito 18
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVTAKKHIPIVKKRTKKFNRHQSDLYKCVASAWRKPKGIDNRVRRRFKGQAAMPSIGYGSNKKTRHMAPSGFKAFLVQNPADVDLLLMHNRTYAAEIGHAVSSRKRVEILAKAKKLGVKVTNPKGRVTTEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.86
3 0.88
4 0.88
5 0.89
6 0.88
7 0.86
8 0.86
9 0.85
10 0.83
11 0.76
12 0.68
13 0.57
14 0.47
15 0.42
16 0.4
17 0.34
18 0.35
19 0.39
20 0.44
21 0.46
22 0.47
23 0.53
24 0.57
25 0.63
26 0.64
27 0.66
28 0.7
29 0.78
30 0.83
31 0.76
32 0.73
33 0.69
34 0.65
35 0.63
36 0.56
37 0.54
38 0.53
39 0.52
40 0.44
41 0.37
42 0.32
43 0.23
44 0.2
45 0.13
46 0.13
47 0.19
48 0.2
49 0.21
50 0.25
51 0.26
52 0.31
53 0.34
54 0.35
55 0.31
56 0.38
57 0.4
58 0.36
59 0.33
60 0.3
61 0.26
62 0.22
63 0.23
64 0.15
65 0.13
66 0.14
67 0.15
68 0.13
69 0.12
70 0.11
71 0.07
72 0.08
73 0.08
74 0.07
75 0.06
76 0.07
77 0.07
78 0.07
79 0.08
80 0.08
81 0.07
82 0.08
83 0.09
84 0.1
85 0.11
86 0.11
87 0.11
88 0.12
89 0.17
90 0.18
91 0.18
92 0.18
93 0.19
94 0.24
95 0.33
96 0.41
97 0.46
98 0.48
99 0.48
100 0.5
101 0.51
102 0.47
103 0.45
104 0.41
105 0.41
106 0.48
107 0.57
108 0.63
109 0.62
110 0.63
111 0.59