Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5J5F646

Protein Details
Accession A0A5J5F646   
Localization Confidence Medium
Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
113-133NSPLPERMRRRRKIEARRDAIBasic
NLS Segment(s)
PositionSequence
120-127MRRRRKIE
Subcellular Location(s) cyto 7.5, cyto_nucl 13, mito 2, nucl 15.5
Family & Domain DBs
Amino Acid Sequences MSCQYEWCAAPQLWEHTRDEHMRTHHHNYYCGHIKRYYPVEYKDDDSVLLKCVCACTVDRYATWPSREHAEEHEEKIRQRGGEGDEQHRAHMASVRAPIPAQVIFAEDYEAENSPLPERMRRRRKIEARRDAIPNDDDDLYAAPLPPRQAAAVEDFHFSDYEDDGDAIVQPRLVPITPQRKLPYASPAHCSDEDEVYTTPLGTRRQIRCRVAAKMPSARREPILGTRENPWDRCTPVAKVKTEHFTPEVCFNSTPAFLRDLAVPETPPPKYGSW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.36
3 0.33
4 0.39
5 0.41
6 0.4
7 0.38
8 0.4
9 0.44
10 0.49
11 0.54
12 0.56
13 0.54
14 0.56
15 0.52
16 0.55
17 0.57
18 0.54
19 0.5
20 0.46
21 0.46
22 0.47
23 0.52
24 0.51
25 0.47
26 0.48
27 0.49
28 0.49
29 0.49
30 0.44
31 0.39
32 0.32
33 0.27
34 0.23
35 0.22
36 0.19
37 0.15
38 0.13
39 0.14
40 0.13
41 0.13
42 0.14
43 0.15
44 0.2
45 0.22
46 0.22
47 0.25
48 0.31
49 0.34
50 0.34
51 0.31
52 0.27
53 0.31
54 0.32
55 0.3
56 0.28
57 0.31
58 0.32
59 0.34
60 0.38
61 0.35
62 0.35
63 0.37
64 0.36
65 0.28
66 0.25
67 0.26
68 0.24
69 0.29
70 0.32
71 0.32
72 0.36
73 0.36
74 0.36
75 0.32
76 0.28
77 0.21
78 0.22
79 0.19
80 0.15
81 0.18
82 0.18
83 0.18
84 0.17
85 0.17
86 0.15
87 0.14
88 0.11
89 0.08
90 0.09
91 0.09
92 0.09
93 0.09
94 0.07
95 0.07
96 0.08
97 0.08
98 0.08
99 0.07
100 0.08
101 0.08
102 0.11
103 0.12
104 0.17
105 0.24
106 0.34
107 0.45
108 0.52
109 0.58
110 0.65
111 0.74
112 0.79
113 0.82
114 0.82
115 0.76
116 0.73
117 0.7
118 0.6
119 0.52
120 0.42
121 0.32
122 0.23
123 0.19
124 0.14
125 0.11
126 0.11
127 0.08
128 0.08
129 0.07
130 0.05
131 0.06
132 0.07
133 0.07
134 0.07
135 0.07
136 0.07
137 0.08
138 0.11
139 0.13
140 0.13
141 0.14
142 0.13
143 0.14
144 0.13
145 0.12
146 0.1
147 0.08
148 0.07
149 0.06
150 0.06
151 0.06
152 0.06
153 0.06
154 0.06
155 0.06
156 0.06
157 0.05
158 0.05
159 0.06
160 0.06
161 0.07
162 0.15
163 0.25
164 0.27
165 0.32
166 0.34
167 0.37
168 0.39
169 0.39
170 0.4
171 0.37
172 0.38
173 0.37
174 0.38
175 0.4
176 0.38
177 0.38
178 0.31
179 0.25
180 0.23
181 0.21
182 0.18
183 0.15
184 0.14
185 0.12
186 0.12
187 0.13
188 0.15
189 0.18
190 0.26
191 0.33
192 0.43
193 0.51
194 0.54
195 0.58
196 0.61
197 0.63
198 0.61
199 0.6
200 0.57
201 0.57
202 0.59
203 0.57
204 0.56
205 0.52
206 0.46
207 0.42
208 0.39
209 0.38
210 0.38
211 0.35
212 0.33
213 0.35
214 0.43
215 0.45
216 0.44
217 0.39
218 0.38
219 0.37
220 0.4
221 0.39
222 0.36
223 0.41
224 0.47
225 0.47
226 0.47
227 0.51
228 0.53
229 0.51
230 0.49
231 0.42
232 0.37
233 0.36
234 0.39
235 0.37
236 0.33
237 0.31
238 0.27
239 0.28
240 0.28
241 0.28
242 0.22
243 0.21
244 0.19
245 0.2
246 0.22
247 0.22
248 0.22
249 0.22
250 0.21
251 0.23
252 0.28
253 0.27
254 0.27