Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5J5EBZ2

Protein Details
Accession A0A5J5EBZ2    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
421-444VDYVLNRNKKVKAKKEPDAETQQIHydrophilic
NLS Segment(s)
PositionSequence
415-417KRR
429-434KKVKAK
Subcellular Location(s) mito 8.5, extr 7, cyto_mito 5.5, plas 4, E.R. 3, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR042163  PHF12  
IPR011011  Znf_FYVE_PHD  
IPR001965  Znf_PHD  
IPR013083  Znf_RING/FYVE/PHD  
Gene Ontology GO:0046872  F:metal ion binding  
GO:0003714  F:transcription corepressor activity  
Amino Acid Sequences MGILRLVFKLFLVVAAFLNCRFPVPLEHLLGIDLSSCYGTRASTYKSHQLTGRKVWSIIFGVPVETAGSGLNGDAEDNAPNLSTGQLMALVRAGSRAIARTEIDPKEMLKWDWETTIKKCRDYQEKLENESKDTHGEAEEERRWLSEMERVETRVFEGKRHEKTSEGDSYRDIAKEWSRQARRMGMERVVMVNGHPVLKETIGNDMWEAVKTFAGKDPRLAEPPRRKKVAIEHQDYCQVCFDGGELITCSGCPRTYHTNCLPESFQPRLKGKGGNFYCPQHECIECEQKTSNAGGLIFRCRWCEYGYCEDCMDWDHTELLGETLPEFELLGFGPIEQAFWIKCQYCVQRHTLDVEAKAMCDEMEKEWAEETARREAAAPELTTEGTTVVGSEVATPVDEVDQAAMLPTLAGDGKKRRRSAVDYVLNRNKKVKAKKEPDAETQQIVQIE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.14
3 0.15
4 0.13
5 0.16
6 0.15
7 0.15
8 0.15
9 0.15
10 0.18
11 0.24
12 0.31
13 0.31
14 0.31
15 0.3
16 0.3
17 0.28
18 0.23
19 0.17
20 0.1
21 0.08
22 0.08
23 0.07
24 0.08
25 0.09
26 0.09
27 0.11
28 0.15
29 0.19
30 0.25
31 0.31
32 0.39
33 0.41
34 0.45
35 0.48
36 0.52
37 0.55
38 0.57
39 0.59
40 0.52
41 0.5
42 0.47
43 0.45
44 0.4
45 0.33
46 0.27
47 0.2
48 0.18
49 0.17
50 0.17
51 0.13
52 0.1
53 0.1
54 0.06
55 0.06
56 0.05
57 0.05
58 0.06
59 0.05
60 0.05
61 0.06
62 0.06
63 0.07
64 0.07
65 0.07
66 0.07
67 0.07
68 0.07
69 0.07
70 0.06
71 0.06
72 0.06
73 0.09
74 0.09
75 0.09
76 0.1
77 0.09
78 0.09
79 0.09
80 0.09
81 0.07
82 0.08
83 0.1
84 0.1
85 0.12
86 0.13
87 0.16
88 0.24
89 0.24
90 0.25
91 0.24
92 0.24
93 0.26
94 0.28
95 0.25
96 0.21
97 0.23
98 0.22
99 0.25
100 0.29
101 0.28
102 0.31
103 0.41
104 0.4
105 0.41
106 0.44
107 0.49
108 0.54
109 0.57
110 0.61
111 0.61
112 0.63
113 0.65
114 0.67
115 0.6
116 0.53
117 0.48
118 0.4
119 0.32
120 0.27
121 0.22
122 0.16
123 0.17
124 0.16
125 0.2
126 0.2
127 0.2
128 0.19
129 0.19
130 0.19
131 0.18
132 0.18
133 0.16
134 0.16
135 0.18
136 0.19
137 0.21
138 0.2
139 0.2
140 0.2
141 0.23
142 0.21
143 0.2
144 0.27
145 0.34
146 0.4
147 0.43
148 0.42
149 0.37
150 0.4
151 0.43
152 0.43
153 0.37
154 0.31
155 0.29
156 0.3
157 0.29
158 0.27
159 0.21
160 0.15
161 0.17
162 0.22
163 0.26
164 0.34
165 0.35
166 0.39
167 0.42
168 0.44
169 0.44
170 0.44
171 0.42
172 0.36
173 0.34
174 0.31
175 0.28
176 0.22
177 0.19
178 0.14
179 0.12
180 0.1
181 0.09
182 0.08
183 0.08
184 0.09
185 0.09
186 0.1
187 0.08
188 0.11
189 0.11
190 0.12
191 0.11
192 0.11
193 0.1
194 0.1
195 0.1
196 0.06
197 0.07
198 0.07
199 0.08
200 0.1
201 0.15
202 0.14
203 0.16
204 0.19
205 0.2
206 0.25
207 0.27
208 0.32
209 0.39
210 0.49
211 0.52
212 0.53
213 0.51
214 0.49
215 0.57
216 0.58
217 0.57
218 0.53
219 0.49
220 0.47
221 0.53
222 0.5
223 0.41
224 0.31
225 0.22
226 0.15
227 0.13
228 0.12
229 0.07
230 0.07
231 0.06
232 0.05
233 0.06
234 0.06
235 0.06
236 0.06
237 0.06
238 0.06
239 0.07
240 0.11
241 0.21
242 0.23
243 0.3
244 0.35
245 0.41
246 0.41
247 0.43
248 0.4
249 0.34
250 0.36
251 0.33
252 0.32
253 0.31
254 0.33
255 0.34
256 0.36
257 0.37
258 0.34
259 0.4
260 0.38
261 0.39
262 0.4
263 0.38
264 0.39
265 0.35
266 0.36
267 0.29
268 0.27
269 0.24
270 0.27
271 0.35
272 0.31
273 0.31
274 0.3
275 0.28
276 0.29
277 0.26
278 0.22
279 0.13
280 0.13
281 0.13
282 0.14
283 0.18
284 0.18
285 0.19
286 0.2
287 0.2
288 0.21
289 0.21
290 0.22
291 0.24
292 0.32
293 0.33
294 0.32
295 0.31
296 0.29
297 0.28
298 0.26
299 0.23
300 0.14
301 0.13
302 0.12
303 0.11
304 0.12
305 0.11
306 0.1
307 0.08
308 0.07
309 0.06
310 0.06
311 0.06
312 0.06
313 0.06
314 0.05
315 0.05
316 0.05
317 0.06
318 0.05
319 0.05
320 0.07
321 0.06
322 0.07
323 0.06
324 0.08
325 0.07
326 0.09
327 0.13
328 0.12
329 0.14
330 0.21
331 0.28
332 0.34
333 0.38
334 0.42
335 0.42
336 0.43
337 0.44
338 0.43
339 0.39
340 0.33
341 0.33
342 0.28
343 0.24
344 0.23
345 0.19
346 0.13
347 0.11
348 0.12
349 0.09
350 0.15
351 0.15
352 0.16
353 0.16
354 0.17
355 0.18
356 0.2
357 0.22
358 0.24
359 0.23
360 0.23
361 0.24
362 0.24
363 0.27
364 0.27
365 0.24
366 0.18
367 0.19
368 0.19
369 0.18
370 0.17
371 0.12
372 0.09
373 0.08
374 0.07
375 0.06
376 0.06
377 0.06
378 0.07
379 0.07
380 0.07
381 0.07
382 0.07
383 0.07
384 0.07
385 0.07
386 0.07
387 0.07
388 0.07
389 0.06
390 0.07
391 0.06
392 0.05
393 0.05
394 0.04
395 0.05
396 0.07
397 0.08
398 0.14
399 0.24
400 0.34
401 0.43
402 0.46
403 0.51
404 0.57
405 0.63
406 0.67
407 0.68
408 0.68
409 0.67
410 0.74
411 0.79
412 0.76
413 0.72
414 0.69
415 0.65
416 0.64
417 0.68
418 0.68
419 0.69
420 0.74
421 0.81
422 0.85
423 0.84
424 0.84
425 0.82
426 0.76
427 0.68
428 0.6