Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H1VER4

Protein Details
Accession H1VER4   
Localization Confidence Medium
Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
226-253QVGSLVRKERRRIRKRHHSSRHDIEQSIBasic
NLS Segment(s)
PositionSequence
232-243RKERRRIRKRHH
Subcellular Location(s) nucl 12.5, cyto_nucl 9, mito 8, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR021858  Fun_TF  
Pfam View protein in Pfam  
PF11951  Fungal_trans_2  
Amino Acid Sequences MVGRSTPPVPWSTPRPETPLSPVLQDKSSILVEYYFKEVCGMMSCYDSKLNPYRTTISNLWGSSPSLYYVTQSMAAACLSEVSPGFAAVSGRLRDQAVGSLWNESRVGPTETSSLLALVMLGFSLCWHDPSRLGQSEFELLAETVAHLETSSNSLTPVDKQKRLFFHNSLVYWKMLLSFVTDDDLPSLSTAYVVQPRPPFETIQRSSRMPHPQTGIGVEIQELVAQVGSLVRKERRRIRKRHHSSRHDIEQSINAIRSAEQLQARLCEIELPREVTVIDSGDDMTSTGHLLKAAEAYRCTGLLQLYRNFPDLVLHGTSP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.53
3 0.52
4 0.51
5 0.52
6 0.51
7 0.44
8 0.41
9 0.42
10 0.38
11 0.36
12 0.34
13 0.28
14 0.25
15 0.24
16 0.2
17 0.16
18 0.16
19 0.16
20 0.17
21 0.21
22 0.17
23 0.16
24 0.17
25 0.16
26 0.15
27 0.17
28 0.17
29 0.14
30 0.17
31 0.17
32 0.18
33 0.21
34 0.2
35 0.23
36 0.29
37 0.34
38 0.34
39 0.37
40 0.4
41 0.4
42 0.47
43 0.42
44 0.38
45 0.37
46 0.35
47 0.32
48 0.29
49 0.28
50 0.22
51 0.21
52 0.17
53 0.14
54 0.14
55 0.13
56 0.13
57 0.13
58 0.13
59 0.12
60 0.11
61 0.1
62 0.09
63 0.08
64 0.07
65 0.07
66 0.06
67 0.07
68 0.06
69 0.07
70 0.07
71 0.07
72 0.07
73 0.07
74 0.07
75 0.08
76 0.12
77 0.12
78 0.12
79 0.14
80 0.14
81 0.13
82 0.14
83 0.15
84 0.11
85 0.13
86 0.13
87 0.15
88 0.15
89 0.16
90 0.16
91 0.13
92 0.14
93 0.14
94 0.16
95 0.13
96 0.14
97 0.14
98 0.14
99 0.15
100 0.13
101 0.1
102 0.08
103 0.07
104 0.06
105 0.04
106 0.04
107 0.03
108 0.02
109 0.02
110 0.02
111 0.05
112 0.05
113 0.07
114 0.08
115 0.09
116 0.11
117 0.14
118 0.2
119 0.22
120 0.23
121 0.21
122 0.21
123 0.22
124 0.21
125 0.18
126 0.12
127 0.09
128 0.08
129 0.07
130 0.06
131 0.04
132 0.04
133 0.04
134 0.03
135 0.03
136 0.04
137 0.06
138 0.06
139 0.06
140 0.06
141 0.07
142 0.07
143 0.1
144 0.19
145 0.23
146 0.27
147 0.29
148 0.34
149 0.37
150 0.42
151 0.44
152 0.36
153 0.37
154 0.37
155 0.36
156 0.33
157 0.31
158 0.26
159 0.21
160 0.19
161 0.14
162 0.1
163 0.09
164 0.08
165 0.07
166 0.07
167 0.08
168 0.08
169 0.07
170 0.07
171 0.08
172 0.06
173 0.06
174 0.06
175 0.05
176 0.05
177 0.05
178 0.07
179 0.12
180 0.13
181 0.17
182 0.19
183 0.21
184 0.25
185 0.26
186 0.26
187 0.25
188 0.34
189 0.33
190 0.37
191 0.38
192 0.35
193 0.37
194 0.42
195 0.47
196 0.4
197 0.41
198 0.38
199 0.37
200 0.37
201 0.35
202 0.29
203 0.2
204 0.18
205 0.13
206 0.1
207 0.08
208 0.07
209 0.06
210 0.05
211 0.04
212 0.04
213 0.04
214 0.05
215 0.06
216 0.07
217 0.11
218 0.17
219 0.23
220 0.32
221 0.42
222 0.51
223 0.61
224 0.71
225 0.78
226 0.84
227 0.89
228 0.92
229 0.93
230 0.92
231 0.91
232 0.9
233 0.88
234 0.81
235 0.71
236 0.62
237 0.55
238 0.49
239 0.42
240 0.33
241 0.23
242 0.19
243 0.18
244 0.19
245 0.17
246 0.18
247 0.17
248 0.19
249 0.2
250 0.21
251 0.22
252 0.19
253 0.18
254 0.18
255 0.18
256 0.21
257 0.22
258 0.24
259 0.23
260 0.23
261 0.23
262 0.18
263 0.19
264 0.14
265 0.12
266 0.09
267 0.1
268 0.09
269 0.09
270 0.08
271 0.07
272 0.07
273 0.07
274 0.07
275 0.07
276 0.08
277 0.09
278 0.09
279 0.14
280 0.17
281 0.19
282 0.19
283 0.22
284 0.22
285 0.22
286 0.22
287 0.19
288 0.2
289 0.21
290 0.26
291 0.28
292 0.33
293 0.36
294 0.38
295 0.36
296 0.32
297 0.3
298 0.26
299 0.26